Sequence 1: | NP_001285019.1 | Gene: | org-1 / 31778 | FlyBaseID: | FBgn0021767 | Length: | 699 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037483.1 | Gene: | TBX21 / 30009 | HGNCID: | 11599 | Length: | 535 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 94/196 - (47%) |
---|---|---|---|
Similarity: | 120/196 - (61%) | Gaps: | 14/196 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 198 VVLETKALWDQFHAQGTEMIITKTGRRMFPTFQVRIGGLDPHATYICMMDFVPMDDKRYRYAFHN 262
Fly 263 SCWVVAGKADPISP-PRIHVHPDSPAVGSNWMKQIVSFDKLKLTNNQLDENG---HIILNSMHRY 323
Fly 324 QPRFHLVYL---PPKNASLDENEHSSHFRTFIFPETSFTAVTAYQNQRVTQLKISSNPFAKGFRD 385
Fly 386 D 386 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
org-1 | NP_001285019.1 | TBOX | 195..389 | CDD:238106 | 94/196 (48%) |
TBX21 | NP_037483.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..62 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 83..109 | ||||
T-box_TBX21 | 136..326 | CDD:410329 | 93/193 (48%) | ||
T-box_assoc | <394..525 | CDD:406561 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 449..535 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3585 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11267 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |