DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment org-1 and TBX21

DIOPT Version :9

Sequence 1:NP_001285019.1 Gene:org-1 / 31778 FlyBaseID:FBgn0021767 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_037483.1 Gene:TBX21 / 30009 HGNCID:11599 Length:535 Species:Homo sapiens


Alignment Length:196 Identity:94/196 - (47%)
Similarity:120/196 - (61%) Gaps:14/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 VVLETKALWDQFHAQGTEMIITKTGRRMFPTFQVRIGGLDPHATYICMMDFVPMDDKRYRYAFHN 262
            |.|....||.:|:...|||||||.||||||.....:.||:|.:.|...:|.|.:|...:||  .:
Human   139 VALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRY--QS 201

  Fly   263 SCWVVAGKADPISP-PRIHVHPDSPAVGSNWMKQIVSFDKLKLTNNQLDENG---HIILNSMHRY 323
            ..||..|||:...| .|::||||||..|::||:|.|||.|||||||:...|.   .|:|.|:|:|
Human   202 GKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKY 266

  Fly   324 QPRFHLVYL---PPKNASLDENEHSSHFRTFIFPETSFTAVTAYQNQRVTQLKISSNPFAKGFRD 385
            |||.|:|.:   .|:.|....|.|     .|.|.||.|.|||||||..:|||||.:||||||||:
Human   267 QPRLHIVEVNDGEPEAACNASNTH-----IFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRE 326

  Fly   386 D 386
            :
Human   327 N 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
org-1NP_001285019.1 TBOX 195..389 CDD:238106 94/196 (48%)
TBX21NP_037483.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..109
T-box_TBX21 136..326 CDD:410329 93/193 (48%)
T-box_assoc <394..525 CDD:406561
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..535
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.