DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment org-1 and Tbx22

DIOPT Version :9

Sequence 1:NP_001285019.1 Gene:org-1 / 31778 FlyBaseID:FBgn0021767 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_851836.2 Gene:Tbx22 / 245572 MGIID:2389465 Length:531 Species:Mus musculus


Alignment Length:246 Identity:116/246 - (47%)
Similarity:154/246 - (62%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KKFKGQHKK-------DNNSAENGTVKPNSHNISKGESEPVHPSLAQAIVV---LETKALWDQFH 210
            |:.|.:..|       ::||.|                     ||.:..|:   |:...||.:||
Mouse    74 KRLKAESSKTVFSCSDESNSQE---------------------SLQEESVIQVELQGSDLWKRFH 117

  Fly   211 AQGTEMIITKTGRRMFPTFQVRIGGLDPHATYICMMDFVPMDDKRYRYAFHNSCWVVAGKAD-PI 274
            ..||||||||.||||||:.::::.|:||...|..::|.||:|.|||||.:|:|.|:|||..| ..
Mouse   118 DIGTEMIITKAGRRMFPSVRIKVKGMDPVKQYYVILDVVPVDSKRYRYVYHSSQWMVAGNTDHSC 182

  Fly   275 SPPRIHVHPDSPAVGSNWMKQIVSFDKLKLTNNQLDENGHIILNSMHRYQPRFHLVYLPPK-NAS 338
            ..||.:||||||..|.|||:||:|||::|||||::|:.|||||.|||:|.||.|:|....: :.|
Mouse   183 ITPRFYVHPDSPCSGENWMRQIISFDRVKLTNNEMDDKGHIILQSMHKYNPRVHVVEQDSRIDLS 247

  Fly   339 LDENEHSSHFRTFIFPETSFTAVTAYQNQRVTQLKISSNPFAKGFRDDGTN 389
            |.|:..:...:||.|.||.||.|||||||::|:|||..|||||||||.|.|
Mouse   248 LIESFPTEGVKTFSFKETEFTTVTAYQNQQITKLKIDRNPFAKGFRDPGRN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
org-1NP_001285019.1 TBOX 195..389 CDD:238106 107/198 (54%)
Tbx22NP_851836.2 TBOX 103..298 CDD:238106 106/194 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.