powered by:
Protein Alignment org-1 and tbx-41
DIOPT Version :9
Sequence 1: | NP_001285019.1 |
Gene: | org-1 / 31778 |
FlyBaseID: | FBgn0021767 |
Length: | 699 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508343.2 |
Gene: | tbx-41 / 188917 |
WormBaseID: | WBGene00006560 |
Length: | 156 |
Species: | Caenorhabditis elegans |
Alignment Length: | 33 |
Identity: | 13/33 - (39%) |
Similarity: | 19/33 - (57%) |
Gaps: | 0/33 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 357 SFTAVTAYQNQRVTQLKISSNPFAKGFRDDGTN 389
:|..||.|:|:....||:..||.|:.|..:.||
Worm 41 TFMTVTMYKNREARVLKLGMNPHARHFLKNNTN 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
org-1 | NP_001285019.1 |
TBOX |
195..389 |
CDD:238106 |
11/31 (35%) |
tbx-41 | NP_508343.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3585 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.