powered by:
Protein Alignment CG1440 and AT5G17140
DIOPT Version :9
Sequence 1: | NP_001285018.1 |
Gene: | CG1440 / 31776 |
FlyBaseID: | FBgn0030038 |
Length: | 551 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_197216.1 |
Gene: | AT5G17140 / 831578 |
AraportID: | AT5G17140 |
Length: | 112 |
Species: | Arabidopsis thaliana |
Alignment Length: | 41 |
Identity: | 13/41 - (31%) |
Similarity: | 18/41 - (43%) |
Gaps: | 5/41 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 465 ESAMTHAMVFTAVSVDKSGVAQKL--RVENSWGEDRGEKGY 503
|:...||::.......|. .|| .|:|:||...|..||
plant 56 ENMERHALIIVGFGTTKD---SKLFFIVQNTWGTKWGFNGY 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D649145at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.