DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1440 and AT5G17140

DIOPT Version :9

Sequence 1:NP_001285018.1 Gene:CG1440 / 31776 FlyBaseID:FBgn0030038 Length:551 Species:Drosophila melanogaster
Sequence 2:NP_197216.1 Gene:AT5G17140 / 831578 AraportID:AT5G17140 Length:112 Species:Arabidopsis thaliana


Alignment Length:41 Identity:13/41 - (31%)
Similarity:18/41 - (43%) Gaps:5/41 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 ESAMTHAMVFTAVSVDKSGVAQKL--RVENSWGEDRGEKGY 503
            |:...||::.......|.   .||  .|:|:||...|..||
plant    56 ENMERHALIIVGFGTTKD---SKLFFIVQNTWGTKWGFNGY 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1440NP_001285018.1 Peptidase_C1_2 102..547 CDD:281100 13/41 (32%)
AT5G17140NP_197216.1 Peptidase_C1 <2..104 CDD:304901 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649145at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.