DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Miga and CG32712

DIOPT Version :9

Sequence 1:NP_001162702.1 Gene:Miga / 31775 FlyBaseID:FBgn0030037 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_727262.2 Gene:CG32712 / 318165 FlyBaseID:FBgn0052712 Length:183 Species:Drosophila melanogaster


Alignment Length:111 Identity:23/111 - (20%)
Similarity:38/111 - (34%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GSSVVTQLTAQQLGMMGMEALDTVINFWEDAL--AAHYSPGGLPALLTTAEDSEFCREIQNLLEM 183
            |:.....|:.|:|..:....:.|::..:...|  .|.|. |.....|.|:........:.::|.:
  Fly    62 GNPDAAHLSRQELSYLRWTVVFTLLYSFATTLLIRAKYL-GNFEISLATSNAMMLMGSLLSVLLV 125

  Fly   184 AYTLQEQSELLFLDQR------------------SVLFREEHSIDE 211
            ..|:.......|.|.|                  ||:|...|||.|
  Fly   126 MVTVALHQHEPFPDLRCNQLVVYHLYYIALNTAISVVFFLVHSIQE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MigaNP_001162702.1 DUF2217 13..523 CDD:287267 23/111 (21%)
CG32712NP_727262.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3831
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.