DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf2 and TBP1

DIOPT Version :9

Sequence 1:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster
Sequence 2:NP_187953.1 Gene:TBP1 / 820546 AraportID:AT3G13445 Length:200 Species:Arabidopsis thaliana


Alignment Length:202 Identity:82/202 - (40%)
Similarity:127/202 - (62%) Gaps:15/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1262 ESSNNAKPIDLHQPIADNEHELDIV--INNVVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTM 1323
            |.||   |:||      ::|...||  :.|:|.:.::.|.|.|:.||||..|.||. :....|.|
plant     7 EGSN---PVDL------SKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIM 62

  Fly  1324 KLRHPYTTASIWSSGRITCTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWA 1388
            ::|.|.|||.|::||::.||||.||..:|:|||:|||.:.|||||.:|.:|:|.|::|:|.:.:.
plant    63 RIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFP 127

  Fly  1389 IKIVNFSERHRENASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASV-NHVESAIQHIYP 1452
            |::...:..|...:||||||.||:.|:|:  .||..|.||.:|.:.:|.|.: :....|.::|||
plant   128 IRLEGLAYSHAAFSSYEPELFPGLIYRMK--VPKIVLLIFVSGKIVITGAKMRDETYKAFENIYP 190

  Fly  1453 LVFDFRK 1459
            ::.:|||
plant   191 VLSEFRK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 72/176 (41%)
PLN00062 1285..1459 CDD:177693 73/177 (41%)
TBP1NP_187953.1 PLN00062 22..200 CDD:177693 74/178 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.