| Sequence 1: | NP_001096905.1 | Gene: | Trf2 / 31773 | FlyBaseID: | FBgn0261793 | Length: | 1715 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038947216.1 | Gene: | Tbpl1 / 689030 | RGDID: | 1597456 | Length: | 238 | Species: | Rattus norvegicus |
| Alignment Length: | 195 | Identity: | 92/195 - (47%) |
|---|---|---|---|
| Similarity: | 122/195 - (62%) | Gaps: | 34/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1298 CHLKLREIALQGSNVEYRRENGMVTMKLRHPYTTASIWSSGRITCTGATSESMAKVAARRYARCL 1362
Fly 1363 GKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYKMRDPDPKATLKI 1427
Fly 1428 FSTGSVTVT--------------------------------AASVNHVESAIQHIYPLVFDFRKQ 1460
Fly 1461 1460 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Trf2 | NP_001096905.1 | GBP_C | <967..1068 | CDD:303769 | |
| coiled coil | 1037..1048 | CDD:293879 | |||
| coiled coil | 1057..1068 | CDD:293879 | |||
| TLF | 1283..1456 | CDD:239953 | 89/189 (47%) | ||
| PLN00062 | 1285..1459 | CDD:177693 | 90/192 (47%) | ||
| Tbpl1 | XP_038947216.1 | TLF | 41..232 | CDD:239953 | 89/189 (47%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166342153 | |
| Domainoid | 1 | 1.000 | 101 | 1.000 | Domainoid score | I6786 |
| eggNOG | 1 | 0.900 | - | - | E1_COG2101 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1219067at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0005864 | |
| OrthoInspector | 1 | 1.000 | - | - | oto95821 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_108142 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR10126 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 10 | 9.750 | |||||