DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf2 and Tbpl2

DIOPT Version :9

Sequence 1:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster
Sequence 2:NP_001092831.1 Gene:Tbpl2 / 680050 RGDID:1596837 Length:344 Species:Rattus norvegicus


Alignment Length:302 Identity:103/302 - (34%)
Similarity:161/302 - (53%) Gaps:34/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1174 SQFSKMQTAGGPSLQRKLANGDTIVLATGSKNMFLTSSEN------KANLPTVASNGNGLITAKM 1232
            |.||.:..:..|. :....|.|..|  ||:|   :|:.|:      ::.|......|:||   .:
  Rat    60 SDFSSVDLSFLPD-ELTQENKDRTV--TGNK---VTNEESFRTQDWQSQLQLPDEQGSGL---NL 115

  Fly  1233 DLLEEEVMQSITVIDDDDEEKKEVAEDEEESSNNAKPIDL------HQPIADNEHELDIV--INN 1289
            :.......||.....|.|..:.    ..|..::||.|:.|      ..|:.:..   .||  :.|
  Rat   116 NSNSSPDTQSCLCSHDADSNQL----SSETPNSNALPVVLISSMTPMNPVTECS---GIVPQLQN 173

  Fly  1290 VVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTMKLRHPYTTASIWSSGRITCTGATSESMAKV 1353
            ||.:.::.|.|.||:|||...|.||. :....|.|::|.|.|||.|:|||::.||||.||..:::
  Rat   174 VVSTANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEDESRL 238

  Fly  1354 AARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYKMRD 1418
            |||:|||.:.|||||.||.||:|.|::.:|.:.:.|::...:..||:.:||||||.||:.|||  
  Rat   239 AARKYARVVQKLGFPVRFFNFKIQNMVASCDVKFPIRLEILALTHRQFSSYEPELFPGLIYKM-- 301

  Fly  1419 PDPKATLKIFSTGSVTVTAASV-NHVESAIQHIYPLVFDFRK 1459
            ..|:..|.||::|.|.:|.|.. :.:..|.:::||::..|:|
  Rat   302 VKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESFKK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 75/176 (43%)
PLN00062 1285..1459 CDD:177693 76/177 (43%)
Tbpl2NP_001092831.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..143 17/76 (22%)
PLN00062 168..344 CDD:177693 76/178 (43%)
TBP_eukaryotes 168..341 CDD:239952 74/174 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.