DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf2 and tbpl2

DIOPT Version :9

Sequence 1:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster
Sequence 2:NP_001017309.1 Gene:tbpl2 / 550063 XenbaseID:XB-GENE-876138 Length:322 Species:Xenopus tropicalis


Alignment Length:320 Identity:95/320 - (29%)
Similarity:164/320 - (51%) Gaps:45/320 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1183 GGPSLQRKLANGDTIVLATGSKNMF--LTSSENKANLPTVASNGNGLITAKMDLLEEEVMQSITV 1245
            |..||:|.|...|...:...|.:|:  :|..::.|..|...::.:..:....:|..:.....::.
 Frog     3 GESSLERYLDQCDAEDVLASSAHMYTPMTPYDDLAIQPLPGTSYSSALEQSKELSTDFSSVDLSF 67

  Fly  1246 IDDDDEEKKEVAEDEEESSNNAK--------PIDLHQPIADNE---------------------- 1280
            :.||..::.|..::::.||.:.:        ..:|.||...:|                      
 Frog    68 LPDDLNQENEDQQEQQTSSQSLEQDSGICLDASNLSQPFTPSECRDASQDSTNLCPMPITPMTPM 132

  Fly  1281 -------HELDIV--INNVVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTMKLRHPYTTASIW 1335
                   ....||  :.|:|.:.::.|.|.|::|||...|.||. :....|.|::|.|.|||.|:
 Frog   133 TPMTPVAESSGIVPQLQNIVSTVNLACKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIF 197

  Fly  1336 SSGRITCTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRE 1400
            |||::.||||.||..:::|||:|||.:.|||||.:||:|:|.|::|:|.:.:.|::......|::
 Frog   198 SSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQ 262

  Fly  1401 NASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASV-NHVESAIQHIYPLVFDFRK 1459
            .:||||||.||:.|:|  ..|:..|.||.:|.|.:|.|.. :.:..|.::|||::..|:|
 Frog   263 FSSYEPELFPGLIYRM--VKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFKK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 72/176 (41%)
PLN00062 1285..1459 CDD:177693 73/177 (41%)
tbpl2NP_001017309.1 PLN00062 145..321 CDD:177693 73/178 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.