DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf2 and tbpl1

DIOPT Version :9

Sequence 1:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster
Sequence 2:NP_001004932.1 Gene:tbpl1 / 448323 XenbaseID:XB-GENE-488460 Length:186 Species:Xenopus tropicalis


Alignment Length:183 Identity:105/183 - (57%)
Similarity:134/183 - (73%) Gaps:2/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1277 ADNEHELDIVINNVVCSFSVGCHLKLREIALQGSNVEYRRENGMVTMKLRHPYTTASIWSSGRIT 1341
            ||::..|||:|.||||.|...|||.||:|||:|.||.|:||.|.|.||||.|..||:|||||:|.
 Frog     3 ADSDVALDIIITNVVCVFRTRCHLNLRKIALEGLNVIYKREVGKVLMKLRKPRITATIWSSGKII 67

  Fly  1342 CTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEP 1406
            |||||||..|||.|||.||.|.||||..:|..|::||||..|:||:.|::..|::::|.:|||||
 Frog    68 CTGATSEEEAKVGARRLARSLQKLGFQVKFTEFKVVNVLAVCTMPFEIRLAEFTKQNRPHASYEP 132

  Fly  1407 ELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASVNHVESAIQHIYPLVFDFRK 1459
            ||||.|.|:::  ..:.||:||||||:|||...|..|.:||:.|||.||:.||
 Frog   133 ELHPAVCYRIK--SLRTTLQIFSTGSITVTGPDVKSVATAIEQIYPFVFESRK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 100/172 (58%)
PLN00062 1285..1459 CDD:177693 99/173 (57%)
tbpl1NP_001004932.1 TLF 9..180 CDD:239953 100/172 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6683
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0005864
OrthoInspector 1 1.000 - - oto102559
Panther 1 1.100 - - LDO PTHR10126
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5023
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.