DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf2 and tbpl2

DIOPT Version :9

Sequence 1:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster
Sequence 2:XP_005169867.1 Gene:tbpl2 / 407713 ZFINID:ZDB-GENE-040520-3 Length:313 Species:Danio rerio


Alignment Length:321 Identity:107/321 - (33%)
Similarity:169/321 - (52%) Gaps:51/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1172 YFSQFSKMQTAGGPSLQRKLANGDTIVLATGSKNMFLTSSENKANLPTVASNGNGLITAKMDL-- 1234
            ||.     ||..|.|  ..:..||  :...||.:....||    .|.::||....| |..:||  
Zfish    12 YFD-----QTIAGSS--DYIFEGD--LGLQGSTSQLQDSS----FLSSLASQEKDL-TEDLDLSF 62

  Fly  1235 LEEEVMQSITVIDDDDEEK------------KEVAEDEEESSNNAK-------------PIDLHQ 1274
            |.:|:.........:.|.|            ||..:.:.::||:|:             |:....
Zfish    63 LPDELSTQDEPSQVEKESKNEDSGIYTDCPQKESTQADIDTSNSAQNTSQFNLPMTPMTPMTPMT 127

  Fly  1275 PIADNEHELDIV--INNVVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTMKLRHPYTTASIWS 1336
            |:|::.   .|:  :.|:|.:.::.|.|.|:.||||..|.||. :....|.|::|.|.|||.|:|
Zfish   128 PVAESS---GIIPQLQNIVSTVNLACPLDLKSIALQARNAEYNPKRFAAVIMRIREPRTTALIFS 189

  Fly  1337 SGRITCTGA-TSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRE 1400
            ||::.|||| :||..:::|||:|||.:.|||||.:||:|:|.|::|:|.:.:.|::......|::
Zfish   190 SGKMVCTGAKSSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVCFPIRLEGLVLTHQQ 254

  Fly  1401 NASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASV-NHVESAIQHIYPLVFDFRKQ 1460
            .:||||||.||:.|:|  ..|:..|.||.:|.|.:|.|.. :.:..|.::|||::..||||
Zfish   255 FSSYEPELFPGLIYRM--VKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFRKQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 72/177 (41%)
PLN00062 1285..1459 CDD:177693 73/178 (41%)
tbpl2XP_005169867.1 PLN00062 136..312 CDD:177693 72/177 (41%)
TBP_eukaryotes 136..310 CDD:239952 71/175 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.