DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf2 and tbp1

DIOPT Version :9

Sequence 1:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster
Sequence 2:NP_594566.1 Gene:tbp1 / 2541582 PomBaseID:SPAC29E6.08 Length:231 Species:Schizosaccharomyces pombe


Alignment Length:249 Identity:84/249 - (33%)
Similarity:136/249 - (54%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1217 LPTVASNGNGLITAKMDLLEEEVMQSIT--VIDDDDEEKKEVAEDEEESSNNAKPIDLHQPIADN 1279
            |||.||..:..:.          ..|:|  |:.:.:.|    |.:|...|.:|:       ::.|
pombe     5 LPTTASQASAFMN----------NSSLTFPVLPNANNE----ATNETADSGDAE-------VSKN 48

  Fly  1280 EHELDIV--INNVVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTMKLRHPYTTASIWSSGRIT 1341
            |....||  :.|:|.:.::.|.|.|:.|||...|.||. :....|.|::|.|.:||.|::||::.
pombe    49 EGVSGIVPTLQNIVATVNLDCRLDLKTIALHARNAEYNPKRFAAVIMRIREPKSTALIFASGKMV 113

  Fly  1342 CTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEP 1406
            ..|..||..:|:|:|:|||.:.||||..:|.:|:|.|::|:|.:.:.|::...:..|...:||||
pombe   114 VLGGKSEDDSKLASRKYARIIQKLGFNAKFTDFKIQNIVGSCDVKFPIRLEGLAYSHGTFSSYEP 178

  Fly  1407 ELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASV-NHVESAIQHIYPLVFDFRK 1459
            ||.||:.|:|  ..||..|.||.:|.:.:|.|.| ..:..|.:.|||::.:|||
pombe   179 ELFPGLIYRM--VKPKVVLLIFVSGKIVLTGAKVREEIYQAFEAIYPVLSEFRK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 66/176 (38%)
PLN00062 1285..1459 CDD:177693 67/177 (38%)
tbp1NP_594566.1 PLN00062 55..230 CDD:177693 66/176 (38%)
TBP_eukaryotes 55..228 CDD:239952 65/174 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.