DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf2 and Tbpl1

DIOPT Version :9

Sequence 1:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster
Sequence 2:NP_035733.1 Gene:Tbpl1 / 237336 MGIID:1339946 Length:186 Species:Mus musculus


Alignment Length:184 Identity:103/184 - (55%)
Similarity:136/184 - (73%) Gaps:2/184 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1277 ADNEHELDIVINNVVCSFSVGCHLKLREIALQGSNVEYRRENGMVTMKLRHPYTTASIWSSGRIT 1341
            ||::..|||:|.||||.|...|||.||:|||:|:||.|:|:.|.|.||||.|..||:|||||:|.
Mouse     3 ADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKII 67

  Fly  1342 CTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEP 1406
            |||||||..||..|||.||.|.||||...|.:|::||||..|:||:.|::..|::.:|.:|||||
Mouse    68 CTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEP 132

  Fly  1407 ELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASVNHVESAIQHIYPLVFDFRKQ 1460
            ||||.|.|:::  ..:|||:||||||:|||..:|..|.:|::.|||.||:.||:
Mouse   133 ELHPAVCYRIK--SLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 98/172 (57%)
PLN00062 1285..1459 CDD:177693 97/173 (56%)
Tbpl1NP_035733.1 TLF 9..180 CDD:239953 98/172 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838364
Domainoid 1 1.000 101 1.000 Domainoid score I6948
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 1 1.000 - - FOG0005864
OrthoInspector 1 1.000 - - oto92258
orthoMCL 1 0.900 - - OOG6_108142
Panther 1 1.100 - - LDO PTHR10126
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5023
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.