DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf2 and Tbp

DIOPT Version :9

Sequence 1:NP_001096905.1 Gene:Trf2 / 31773 FlyBaseID:FBgn0261793 Length:1715 Species:Drosophila melanogaster
Sequence 2:NP_038712.3 Gene:Tbp / 21374 MGIID:101838 Length:316 Species:Mus musculus


Alignment Length:175 Identity:75/175 - (42%)
Similarity:116/175 - (66%) Gaps:4/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1287 INNVVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTMKLRHPYTTASIWSSGRITCTGATSESM 1350
            :.|:|.:.::||.|.|:.|||:..|.||. :....|.|::|.|.|||.|:|||::.||||.||..
Mouse   142 LQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQ 206

  Fly  1351 AKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYK 1415
            :::|||:|||.:.|||||.:||:|:|.|::|:|.:.:.|::......|::.:||||||.||:.|:
Mouse   207 SRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYR 271

  Fly  1416 MRDPDPKATLKIFSTGSVTVTAASVN-HVESAIQHIYPLVFDFRK 1459
            |  ..|:..|.||.:|.|.:|.|.|. .:..|.::|||::..|||
Mouse   272 M--IKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf2NP_001096905.1 GBP_C <967..1068 CDD:303769
coiled coil 1037..1048 CDD:293879
coiled coil 1057..1068 CDD:293879
TLF 1283..1456 CDD:239953 72/170 (42%)
PLN00062 1285..1459 CDD:177693 73/173 (42%)
TbpNP_038712.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..135
PLN00062 139..315 CDD:177693 75/175 (43%)
TBP_eukaryotes 139..312 CDD:239952 72/171 (42%)
Repetitive region 142..218 35/75 (47%)
Repetitive region 232..309 29/78 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.