DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10555 and GIF2

DIOPT Version :9

Sequence 1:NP_001285016.1 Gene:CG10555 / 31771 FlyBaseID:FBgn0030034 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001154298.1 Gene:GIF2 / 839278 AraportID:AT1G01160 Length:229 Species:Arabidopsis thaliana


Alignment Length:327 Identity:78/327 - (23%)
Similarity:90/327 - (27%) Gaps:145/327 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QQQQRPPMGVPGSPGSIISGGGGGGGVIGGGGMPGGGMMVTPTSTPRGGANMQGGGGGGVPQQVN 144
            ||||.|.|                             ..:.|:..|   ||           .:.
plant     2 QQQQSPQM-----------------------------FPMVPSIPP---AN-----------NIT 23

  Fly   145 SAQIQKM----------------------------------LDENCGLIQTIQDFQSMGKAQECM 175
            :.|||||                                  ||||..||..|.:.|::||..||.
plant    24 TEQIQKMLGGSGNFESGFQEWTLKLDACLMLLFCTFSWLDYLDENKKLIMAIMENQNLGKLAECA 88

  Fly   176 SYHVALHRNLVYLAQLADPAMNISQILPPPHILQTQAMQQGGQQTPPTGPHGMLGGPPQQQQQPG 240
            .|...|.:||:|||.:||                       .|..|||               ||
plant    89 QYQALLQKNLMYLAAIAD-----------------------AQPPPPT---------------PG 115

  Fly   241 QGPVPGQPGQ-GPPQMGMQQHGGDPQGPPVQMPPYGAQQQPQPHPG---LPPGAQQQSQQQQQQQ 301
            ..|......| ..|..|||             ||....|.||..|.   .|.|..|.....|.|.
plant   116 PSPSTAVAAQMATPHSGMQ-------------PPSYFMQHPQASPAGIFAPRGPLQFGSPLQFQD 167

  Fly   302 QQQQQQQQQQQQQQQAAAAAAAAAAAAAVAAGQQQ----GPQVSQAGPQQQQQQQHPVYRNAQGQ 362
            .|||||..||..|.................|.||.    |..|...|.:|.         .|.||
plant   168 PQQQQQIHQQAMQGHMGIRPMGMTNNGMQHAMQQPETGLGGNVGLRGGKQD---------GADGQ 223

  Fly   363 GQ 364
            |:
plant   224 GK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10555NP_001285016.1 SSXT 141..200 CDD:282835 26/92 (28%)
GIF2NP_001154298.1 SSXT 63..108 CDD:282835 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4149
eggNOG 1 0.900 - - E1_KOG3227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001535
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105891
Panther 1 1.100 - - LDO PTHR23107
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.