DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10555 and AN3

DIOPT Version :9

Sequence 1:NP_001285016.1 Gene:CG10555 / 31771 FlyBaseID:FBgn0030034 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_198216.2 Gene:AN3 / 832968 AraportID:AT5G28640 Length:210 Species:Arabidopsis thaliana


Alignment Length:317 Identity:77/317 - (24%)
Similarity:99/317 - (31%) Gaps:131/317 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 MQGGGGGGVPQQVNSAQIQKMLDENCGLIQTIQDFQSMGKAQECMSYHVALHRNLVYLAQLADPA 195
            ||....|..|..|.|..||:.||||..||..|.:.|:.||..||......|.|||:|||.:||  
plant     8 MQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIAD-- 70

  Fly   196 MNISQILPPPHILQTQAMQQGGQQTPPTGPHGMLGGPPQQQQQPGQGPVPGQPGQGPPQMGMQQH 260
               ||  |.|..:.:|              :|..||          |.:.|:.|           
plant    71 ---SQ--PQPPSVHSQ--------------YGSAGG----------GMIQGEGG----------- 95

  Fly   261 GGDPQGPPVQMPPYGAQQQPQPHPGLPPGAQQQSQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAA 325
                                                  ....||||..||||..||:..||.::.
plant    96 --------------------------------------SHYLQQQQATQQQQMTQQSLMAARSSM 122

  Fly   326 AAAAVAAGQQQGPQVSQAGPQQQQQQQHPVYRNAQGQ----GQPGAGQVPGQGQGPVQSVINPNA 386
            ..|                  ||||||.| |...|.|    .|.|.....|.|......::    
plant   123 LYA------------------QQQQQQQP-YATLQHQQLHHSQLGMSSSSGGGGSSGLHIL---- 164

  Fly   387 APNQQRPNNGPLSGPQNPQQQQQQPQPGGQQPPNQQQQQQQTGPGGPGPQPGAGGPG 443
                                   |.:.||.....:.:.:..:|.||.| :.|:.|.|
plant   165 -----------------------QGEAGGFHDFGRGKPEMGSGGGGEG-RGGSSGDG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10555NP_001285016.1 SSXT 141..200 CDD:282835 25/58 (43%)
AN3NP_198216.2 SSXT 20..75 CDD:282835 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4149
eggNOG 1 0.900 - - E1_KOG3227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001535
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23107
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.