DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10555 and GIF3

DIOPT Version :9

Sequence 1:NP_001285016.1 Gene:CG10555 / 31771 FlyBaseID:FBgn0030034 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_567194.1 Gene:GIF3 / 827995 AraportID:AT4G00850 Length:223 Species:Arabidopsis thaliana


Alignment Length:313 Identity:88/313 - (28%)
Similarity:107/313 - (34%) Gaps:105/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 MQQQQQRPPMGVPGSPGSIISGGGGGGGVIGGGGMPGGGMMVTPTSTPRGGANMQGGGGGGVPQQ 142
            |||..|..||.:|..|                           ||:                  .
plant     1 MQQSPQMIPMVLPSFP---------------------------PTN------------------N 20

  Fly   143 VNSAQIQKMLDENCGLIQTIQDFQSMGKAQECMSYHVALHRNLVYLAQLADPAMNISQILPPPHI 207
            :.:.||||.||||..||..|.:.|::||..||..|...|.:||:|||.:||     :|..||...
plant    21 ITTEQIQKYLDENKKLIMAILENQNLGKLAECAQYQALLQKNLMYLAAIAD-----AQPQPPAAT 80

  Fly   208 LQTQAMQQGGQQTPPTGPHGMLGGPPQQQQQPGQGPVPGQPGQGPPQMGMQQH---GGDPQGPPV 269
            |.:.||.          |..|...|...|.              ||...||||   |...|.||.
plant    81 LTSGAMT----------PQAMAPNPSSMQP--------------PPSYFMQQHQAVGMAQQIPPG 121

  Fly   270 QMPPYGAQQQPQPHPGLPPGAQQQSQQQQQQQQ--------QQQQQQQQQQQQQQAAAAAAAAAA 326
            ..||.|..|...||..|.|  |||..||..|..        ......|.|....:.|.||..|..
plant   122 IFPPRGPLQFGSPHQFLDP--QQQLHQQAMQGHMGIRPMGLNNNNGLQHQMHHHETALAANNAGP 184

  Fly   327 AAAVAAGQQQGPQVSQAGPQQQQQQQHPVYRNAQGQG----QPGAGQVPGQGQ 375
            ..|...|:..|..:||:|              |.|||    :.|.|....:|:
plant   185 NDASGGGKPDGTNMSQSG--------------ADGQGGSAARHGGGDAKTEGK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10555NP_001285016.1 SSXT 141..200 CDD:282835 25/58 (43%)
GIF3NP_567194.1 SSXT 21..74 CDD:368251 25/57 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4149
eggNOG 1 0.900 - - E1_KOG3227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001535
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105891
Panther 1 1.100 - - O PTHR23107
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.