DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10555 and Ss18l2

DIOPT Version :9

Sequence 1:NP_001285016.1 Gene:CG10555 / 31771 FlyBaseID:FBgn0030034 Length:926 Species:Drosophila melanogaster
Sequence 2:XP_003750654.1 Gene:Ss18l2 / 687029 RGDID:1590139 Length:77 Species:Rattus norvegicus


Alignment Length:52 Identity:26/52 - (50%)
Similarity:38/52 - (73%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 QVNSAQIQKMLDENCGLIQTIQDFQSMGKAQECMSYHVALHRNLVYLAQLAD 193
            :||...||::|:||..||:.|.::|:.|:|.||:.|...|||||:|||.:||
  Rat    15 KVNQETIQRLLEENDQLIRCIVEYQNKGRANECVQYQHVLHRNLIYLATIAD 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10555NP_001285016.1 SSXT 141..200 CDD:282835 26/52 (50%)
Ss18l2XP_003750654.1 SSXT 14..71 CDD:398622 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9672
eggNOG 1 0.900 - - E1_KOG3227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1442230at2759
OrthoFinder 1 1.000 - - FOG0001535
OrthoInspector 1 1.000 - - otm44433
orthoMCL 1 0.900 - - OOG6_105891
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.