DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10555 and SS18L2

DIOPT Version :9

Sequence 1:NP_001285016.1 Gene:CG10555 / 31771 FlyBaseID:FBgn0030034 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001357229.1 Gene:SS18L2 / 51188 HGNCID:15593 Length:77 Species:Homo sapiens


Alignment Length:52 Identity:25/52 - (48%)
Similarity:37/52 - (71%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 QVNSAQIQKMLDENCGLIQTIQDFQSMGKAQECMSYHVALHRNLVYLAQLAD 193
            :||...||::|:||..||:.|.::|:.|:..||:.|...|||||:|||.:||
Human    15 EVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIAD 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10555NP_001285016.1 SSXT 141..200 CDD:282835 25/52 (48%)
SS18L2NP_001357229.1 SSXT 14..73 CDD:398622 25/52 (48%)
SH2-binding. /evidence=ECO:0000255 50..53 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10113
eggNOG 1 0.900 - - E1_KOG3227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1442230at2759
OrthoFinder 1 1.000 - - FOG0001535
OrthoInspector 1 1.000 - - otm40304
orthoMCL 1 0.900 - - OOG6_105891
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4299
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.