powered by:
Protein Alignment CG10555 and SS18L2
DIOPT Version :9
Sequence 1: | NP_001285016.1 |
Gene: | CG10555 / 31771 |
FlyBaseID: | FBgn0030034 |
Length: | 926 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001357229.1 |
Gene: | SS18L2 / 51188 |
HGNCID: | 15593 |
Length: | 77 |
Species: | Homo sapiens |
Alignment Length: | 52 |
Identity: | 25/52 - (48%) |
Similarity: | 37/52 - (71%) |
Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 QVNSAQIQKMLDENCGLIQTIQDFQSMGKAQECMSYHVALHRNLVYLAQLAD 193
:||...||::|:||..||:.|.::|:.|:..||:.|...|||||:|||.:||
Human 15 EVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIAD 66
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
64 |
1.000 |
Domainoid score |
I10113 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3227 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1442230at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001535 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm40304 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105891 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4299 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.750 |
|
Return to query results.
Submit another query.