DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1387 and F41E6.11

DIOPT Version :9

Sequence 1:NP_572473.1 Gene:CG1387 / 31770 FlyBaseID:FBgn0030033 Length:955 Species:Drosophila melanogaster
Sequence 2:NP_505224.1 Gene:F41E6.11 / 179245 WormBaseID:WBGene00018292 Length:316 Species:Caenorhabditis elegans


Alignment Length:103 Identity:22/103 - (21%)
Similarity:36/103 - (34%) Gaps:26/103 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PSANDIYPRSHIMQADQASAASNSNSGQFLYSMMQANRSRSMSFTAARPYASVYGQSSVRRVASS 131
            |:.|   |.|:::::..|:|..                       .|:.||..|.|......|.|
 Worm   238 PAYN---PYSYVLRSPVAAAPG-----------------------YAQGYAPAYAQGYAPAYAPS 276

  Fly   132 SCSSGRSSESSRTGFLVGSFRKSKAKRERQSRSMRKSK 169
            ...:...|...|..:|:||.:..||.....:.:..|.|
 Worm   277 YAPAYAPSPFRRAMYLLGSNKGKKAAAAAAAATEEKKK 314



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMBI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.