DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1387 and ceh-86

DIOPT Version :9

Sequence 1:NP_572473.1 Gene:CG1387 / 31770 FlyBaseID:FBgn0030033 Length:955 Species:Drosophila melanogaster
Sequence 2:NP_494274.3 Gene:ceh-86 / 173597 WormBaseID:WBGene00018355 Length:733 Species:Caenorhabditis elegans


Alignment Length:281 Identity:60/281 - (21%)
Similarity:114/281 - (40%) Gaps:49/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 QNWAI-PSGSATKLRSIEGKTKDDTLESTKLNSEHGKANSNSGSTSHDTSQANSEAASVQDESNR 566
            ||:.| |:.|..:|...|.||:..||.         |..:::.:.:|..:||:::|....|...:
 Worm   407 QNYRILPNSSDKRLEEHELKTQSSTLP---------KPCAHAQAQAHAQAQAHAQAHETNDNWPK 462

  Fly   567 ATLAPVRRVHLQQQSL--QNSTKV----EEPKCEDVPISPHEVKDTVKEKAKENVKKKQLLETLH 625
             .:..:.|..||.|||  |:..::    .:|.......:.||:      .|.|....||||..|:
 Worm   463 -LMTELFRALLQGQSLTQQHMQRLVHLRTQPDFNRRSYAGHEL------TAMEMEALKQLLNLLN 520

  Fly   626 DKPRVTKVTSNQVSRSSHRSFLQPAKDDDVTAANAS-KKSHPKLGKKPERKANQKREDRTPGQVK 689
            .|...|                  .|.::|..:..: .::|..:|.....:..::.|.....|..
 Worm   521 GKEMPT------------------GKKEEVEGSGLTISEAHGTVGSPMLIEKKEELEGSLEHQPT 567

  Fly   690 GANQLLVASASQVSAYKRAFRTQQQIRKA---EILQQQAQHLQESPISPSAIEGSKQTAKLQSHQ 751
            .||:.:..:..:.:..|..:|.:.::.|.   |:||:  ..|:|.....:..|.:.|..||.  :
 Worm   568 MANEEIDQNLKEETTTKPEYRKKLRMSKRKQNELLQK--LWLKEKNTENTHAEKTNQEKKLT--E 628

  Fly   752 GSIQQSISNRTNVRTLVRRSA 772
            .::|:.:.....:....||:|
 Worm   629 NAVQEQLEQMMKMIQEERRAA 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1387NP_572473.1 None
ceh-86NP_494274.3 HOX 227..282 CDD:197696
PTZ00121 <552..709 CDD:173412 20/102 (20%)
Rabaptin <613..>678 CDD:367545 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMBI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.