DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and GluClalpha

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster


Alignment Length:344 Identity:76/344 - (22%)
Similarity:151/344 - (43%) Gaps:78/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SFISSSTAN-------PDAKRLYDDLL--SNYNKLVRPV-VNVTDA-LTVRIKL---KLSQLIDV 65
            |..|:|.||       ...|::.|.:|  ..|:..:||. :|.||. ..||:.:   .:|::.||
  Fly    15 SLCSASLANNAKINFREKEKKVLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDV 79

  Fly    66 NLKNQIMTTNLWVEQSWYDYKLKWEPKEYGGVEMLHV-PSDHIWRPDIVLYNNADGNFE------ 123
            .::..:..|   ..:.|.|.:||::..: |.::.|.: .::.:|.||:...|..:|:|.      
  Fly    80 TMEYSVQLT---FREQWTDERLKFDDIQ-GRLKYLTLTEANRVWMPDLFFSNEKEGHFHNIIMPN 140

  Fly   124 --VTLATKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDEQTCVMKFGS--WTYDGFQVDLRHI- 183
              :.:....::.|:.|:.      ...:|.::::.:|.|.|.|.::..|  ||.:    ||..: 
  Fly   141 VYIRIFPNGSVLYSIRIS------LTLACPMNLKLYPLDRQICSLRMASYGWTTN----DLVFLW 195

  Fly   184 DELNGTNVVEVGVDLSEFYTSVEWDILEVPAVRNEKFYT-CCDE-----PYLDITFNITMRRKTL 242
            .|.:...||:               .|.:|....|||.| .|:.     .|..:..::..:|:..
  Fly   196 KEGDPVQVVK---------------NLHLPRFTLEKFLTDYCNSKTNTGEYSCLKVDLLFKREFS 245

  Fly   243 FYTVNLIIPCMGISFLTILVFYLPSDSG---EKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLL 304
            :|.:.:.|||..:..::.:.|:|  |.|   .:|||.::.||::......:...:||.|      
  Fly   246 YYLIQIYIPCCMLVIVSWVSFWL--DQGAVPARVSLGVTTLLTMATQTSGINASLPPVS------ 302

  Fly   305 GKFVLFTMILDTFS-ICVT 322
                 :|..:|.:: :|:|
  Fly   303 -----YTKAIDVWTGVCLT 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 51/239 (21%)
Neur_chan_memb 248..>359 CDD:280999 19/79 (24%)
Neur_chan_memb <683..760 CDD:280999
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 76/344 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.