DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and lgc-29

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001317792.1 Gene:lgc-29 / 3896858 WormBaseID:WBGene00044528 Length:398 Species:Caenorhabditis elegans


Alignment Length:319 Identity:75/319 - (23%)
Similarity:144/319 - (45%) Gaps:44/319 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RLYDDLLSNYNKLVR--------PVVNVT---DALTVRIKLKLSQLIDVNLKNQIMTTNLWVEQS 81
            ||::.|..:|:..:.        |..|.|   ....:.|:|.:.:|::|....:..|........
 Worm    40 RLFEKLFKSYDPGINAIYTLHSVPETNGTVHPPRFEITIQLSMMKLVEVVEPEEKATFLFDYRAD 104

  Fly    82 WYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVL---YNNADGNFEVTLATKATLNYTGRVEWRPP 143
            |||.:|.|:|::|||:..::||...:|.|:..:   :::....|:......|.|:..|.:.....
 Worm   105 WYDTRLSWDPEDYGGINHIYVPRSKVWIPETTIVDCFSSEIKVFDNEYTRYAWLHSNGSIGMYIA 169

  Fly   144 AIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGT---NVVEVGVDLSEFYTSV 205
            ::....|::||..||.|..||.:.|...||   |::...|....||   .|.::|        :.
 Worm   170 SVTSVVCQMDVYKFPMDTHTCSVNFLFMTY---QLEEFTIVGKTGTLPRPVEQLG--------NG 223

  Fly   206 EWDILEV-----PAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYL 265
            ||.:..:     |.|.|..:.|         .|..|..|...||.|.::||...|:.|:|:..::
 Worm   224 EWQMKSIQIAFEPVVDNLTYLT---------KFEATFSRNPGFYIVLVMIPAYFINVLSIVALFM 279

  Fly   266 P-SDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTV 323
            . ::..||.::.::.::|::...::|||.:|.|. .:|:|..:.:.::.:...|:...|
 Worm   280 DINNRSEKFTVGMTNIMSMSFILVILAEDLPKTK-NLPILAIYTVTSLAIMLCSLTAVV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 55/234 (24%)
Neur_chan_memb 248..>359 CDD:280999 17/77 (22%)
Neur_chan_memb <683..760 CDD:280999
lgc-29NP_001317792.1 LIC 38..>337 CDD:273305 74/317 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.