DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and ZACN

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_851321.2 Gene:ZACN / 353174 HGNCID:29504 Length:412 Species:Homo sapiens


Alignment Length:347 Identity:66/347 - (19%)
Similarity:139/347 - (40%) Gaps:66/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FQVTIDMILVLSFISSSTANPDAKRLYDDLLSNYNKLVRPVVNVTD----ALTVRIKLKLSQLID 64
            |.:|:.::....|..::...|....:      |.:|.|:..:.:.:    .|.|.:::.:|.:.:
Human    15 FSITLLLVHGQGFQGTAAIWPSLFNV------NLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFN 73

  Fly    65 VNLKNQIMTTNLWVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYN------------- 116
            |::....|::.|.:..||.|.:|.|....:.. ..:.:|.:.:|.|.:.:..             
Human    74 VDILRYTMSSMLLLRLSWLDTRLAWNTSAHPR-HAITLPWESLWTPRLTILEALWVDWRDQSPQA 137

  Fly   117 --NADGNFEVTLATKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVD 179
              :.||:.::.||.....|                |..::.:||.|...|.:.|.:.:....:::
Human   138 RVDQDGHVKLNLALATETN----------------CNFELLHFPRDHSNCSLSFYALSNTAMELE 186

  Fly   180 LRHIDELNGTNVVEVGVDLSEFYTSVEWDI-LEVPAVRNEKFYTCCDEPYLDITFNITMRRK--T 241
            .:       .:||...|.:...|  |.:|: .:||.   ::...|         |.:|:|.|  .
Human   187 FQ-------AHVVNEIVSVKREY--VVYDLKTQVPP---QQLVPC---------FQVTLRLKNTA 230

  Fly   242 LFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGK 306
            |...:.|::|...:....:....||..:.|::...:::|||..|....|.:.:|.:|...|||..
Human   231 LKSIIALLVPAEALLLADVCGGLLPLRAIERIGYKVTLLLSYLVLHSSLVQALPSSSSCNPLLIY 295

  Fly   307 FVLFTMILDTFSICVTVLVLNI 328
            :....::|...|...|||:..:
Human   296 YFTILLLLLFLSTIETVLLAGL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 41/236 (17%)
Neur_chan_memb 248..>359 CDD:280999 20/81 (25%)
Neur_chan_memb <683..760 CDD:280999
ZACNNP_851321.2 LIC 11..368 CDD:273305 66/347 (19%)
Neur_chan_LBD 54..>187 CDD:280998 25/149 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.