DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and nAChRbeta3

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_525098.1 Gene:nAChRbeta3 / 33228 FlyBaseID:FBgn0031261 Length:441 Species:Drosophila melanogaster


Alignment Length:333 Identity:97/333 - (29%)
Similarity:174/333 - (52%) Gaps:30/333 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QVTIDMILV-LSFISSSTANPDAK--------RLYDDLLSNYNKLVRPVVNVTDALTVRIKLKLS 60
            |:.:.|:|: |:.:..:||..|.|        ||:..|.:||:..|:||...|.. .|.:::.::
  Fly    21 QMLMGMLLMGLTSVPGATATADPKNANVKALDRLHAGLFTNYDSDVQPVFQGTPT-NVSLEMVVT 84

  Fly    61 QLIDVNLKNQIMTTNLWVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVT 125
             .||::..|..:||:.|:...|.|.:..|:|.:|..:..:.:.|..:|.|.|.|:|..:|.  :.
  Fly    85 -YIDIDELNGKLTTHCWLNLRWRDEERVWQPSQYDNITQITLKSSEVWTPQITLFNGDEGG--LM 146

  Fly   126 LATKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGTN 190
            ..|:.||::.|...|.|||:|.:.||:::..:|.|:|:|.:|.|||   |.:|.|..    |||.
  Fly   147 AETQVTLSHDGHFRWMPPAVYTAYCELNMLNWPHDKQSCKLKIGSW---GLKVVLPE----NGTA 204

  Fly   191 VVEVGVDLSEFYTSVEWDILEVPA-VRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMG 254
            ..| .:|..:...|.||:|::..| ..::.:|     .|::.|  :|.:|::..||..:..|...
  Fly   205 RGE-SLDHDDLVQSPEWEIVDSRAHFVSQDYY-----GYMEYT--LTAQRRSSMYTAVIYTPASC 261

  Fly   255 ISFLTILVFYLPSD-SGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFS 318
            |..|.:..|:||.. .|||:.::..:::.:..|.:..|:::|..|...||:..|...:::..:.|
  Fly   262 IVILALSAFWLPPHMGGEKIMINGLLIIVIAAFLMYFAQLLPVLSNNTPLVVIFYSTSLLYLSVS 326

  Fly   319 ICVTVLVL 326
            ..|.||||
  Fly   327 TIVEVLVL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 66/223 (30%)
Neur_chan_memb 248..>359 CDD:280999 22/80 (28%)
Neur_chan_memb <683..760 CDD:280999
nAChRbeta3NP_525098.1 LIC 39..437 CDD:273305 92/315 (29%)
Neur_chan_LBD 52..247 CDD:280998 64/213 (30%)
Neur_chan_memb 255..434 CDD:280999 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447326
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.