DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and Chrna5

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_058774.2 Gene:Chrna5 / 25102 RGDID:2347 Length:467 Species:Rattus norvegicus


Alignment Length:342 Identity:172/342 - (50%)
Similarity:243/342 - (71%) Gaps:15/342 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISSSTANPDAKRLYDDLLSNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKNQIMTTNLWVEQS 81
            :||:..:.|:  |:.||..:|.:.||||.:::|.:.::..|.:|||:||:.|||:||||:|::|.
  Rat    40 LSSAAKHEDS--LFRDLFEDYERWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQE 102

  Fly    82 WYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNYTGRVEWRPPAIY 146
            |.|.||:|.|.:|||::::.||||.:|.|||||::||||.|| ..:||..:.|.|.|.|..||.|
  Rat   103 WIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFE-GASTKTVVRYNGTVTWTQPANY 166

  Fly   147 KSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGTNVVEVGVDLSEFYTSVEWDILE 211
            ||||.|||.:||||.|.|.||||||||||.|||:...|:         .||.::|:.:.||:|:.
  Rat   167 KSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQ---------DVDRTDFFDNGEWEIMS 222

  Fly   212 VPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLS 276
            ....:..:..:||..||  ||::..::|..||||:.|||||:|:||||::||||||:.|||:||.
  Rat   223 AMGSKGNRTDSCCWYPY--ITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLC 285

  Fly   277 ISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVLVLNIHFRSPQTH-TMAP 340
            .|:|:|||||.|::.||||.:|.|:||:|::::||||..|.||.|||..:|||.||..|| .|||
  Rat   286 TSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAP 350

  Fly   341 WVRTVFINQLPRFLVMR 357
            |||.:|:::||:.|.||
  Rat   351 WVRKIFLHKLPKLLCMR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 98/214 (46%)
Neur_chan_memb 248..>359 CDD:280999 67/111 (60%)
Neur_chan_memb <683..760 CDD:280999
Chrna5NP_058774.2 LIC 41..448 CDD:273305 172/341 (50%)
Neur_chan_LBD 47..250 CDD:280998 99/216 (46%)
Neur_chan_memb 257..446 CDD:280999 67/111 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 253 1.000 Domainoid score I1995
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.