DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and Chrna9

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001074573.1 Gene:Chrna9 / 231252 MGIID:1202403 Length:479 Species:Mus musculus


Alignment Length:352 Identity:158/352 - (44%)
Similarity:226/352 - (64%) Gaps:15/352 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TANPD-AKRLYDDLLSNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKNQIMTTNLWVEQSWYD 84
            |||.. |::|:.||..:|:..:|||.:....|.|.:::.|||:.|::.:|||:|..||:.|:|:|
Mouse    25 TANGKYAQKLFSDLFEDYSNALRPVEDTDAVLNVTLQVTLSQIKDMDERNQILTAYLWIRQTWHD 89

  Fly    85 YKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNYTGRVEWRPPAIYKSS 149
            ..|.|:..:|.|::.:.:|||.:|||||||||.||......:.|...|.|.|.:.|..|||.|||
Mouse    90 AYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDSPAITKSS 154

  Fly   150 CEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGTNVVEVGVDLSEFYTSVEWDILEVPA 214
            |.:||.|||||.|.|.:.||||||:|.|||:        .|.::.| |||:|...|||::..:||
Mouse   155 CVVDVTYFPFDSQQCNLTFGSWTYNGNQVDI--------FNALDSG-DLSDFIEDVEWEVQGMPA 210

  Fly   215 VRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLSISI 279
            |:|...|.||.|||.|:||.:.::|::.||.|||:|||:.||||..|.||||:.|||||||.::|
Mouse   211 VKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTI 275

  Fly   280 LLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVLVLNIHFRSPQTHTMAPWVRT 344
            ||::|||.|::|||: |.|..|||:||:.:.||.|.|.|..:|::|:||||...:...:..|.:.
Mouse   276 LLAMTVFQLMVAEIM-PASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWAKV 339

  Fly   345 VFINQLPRFLVMRRPLYPISEMIKSSR 371
            |.:..:.|.|.    :|.:.|...|.|
Mouse   340 VILKYMSRILF----VYDVGESCLSPR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 95/214 (44%)
Neur_chan_memb 248..>359 CDD:280999 52/110 (47%)
Neur_chan_memb <683..760 CDD:280999
Chrna9NP_001074573.1 LIC 10..474 CDD:273305 158/352 (45%)
Neur_chan_LBD 31..236 CDD:280998 94/213 (44%)
Neur_chan_memb 244..474 CDD:280999 56/124 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.