DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and lgc-18

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_510029.3 Gene:lgc-18 / 187977 WormBaseID:WBGene00011360 Length:399 Species:Caenorhabditis elegans


Alignment Length:348 Identity:82/348 - (23%)
Similarity:153/348 - (43%) Gaps:85/348 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RLYDDLLSNYNKLVRPVVNVTDA---------------LTVRI-KLKLSQLIDVNLKNQIMTTNL 76
            :|..|:.:||:..:.||....|.               .||.: .|||.::|:...|..::   |
 Worm    36 KLIKDVFTNYDNTLSPVYTKIDPTQPIGYNPLAPKRFNYTVSLYYLKLVEVIEPEEKVSVV---L 97

  Fly    77 WVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNAD-----------------GNFEV 124
            .:.:.|||.::.|:...||.::|||:..|.:|.|.:.|:...|                 |:...
 Worm    98 EMAEYWYDPRIAWDSSLYGDIKMLHMRQDKVWSPTLSLFRINDIADFRDPDFRMVCVENTGHTYT 162

  Fly   125 TLATKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDEQTCVMKFG------------SWTYDGFQ 177
            ||:.|.:||                |.:||..||:|.|||.::|.            |..|:|. 
 Worm   163 TLSVKISLN----------------CPLDVSMFPYDSQTCRIQFNMPLFFMQQVEMFSQIYEGI- 210

  Fly   178 VDLRHIDELNGTNVVEVGVDLSEFYTSVEWDILEVP-AVRNEKFYTCCDEPYLDITFNITMRRKT 241
                    ||.|...::|        :.||::..:. :|....:.....:..| .||.|.:||..
 Worm   211 --------LNSTVWEKMG--------NSEWELANLTHSVELLSYGDGLGDMQL-ATFEIRIRRNP 258

  Fly   242 LFYTVNLIIPCMGISFLTIL-VFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLG 305
            ::|...:|.|...|:.|:|: ||...:|...|:::.::.::::|....::|:.||.|. .:||||
 Worm   259 MYYIYMIIFPSFIINALSIIGVFLKKTDKMSKLNVGLTNIMTMTFILGVMADKIPKTG-SIPLLG 322

  Fly   306 KFVLFTMILDTFSICVTVLVLNI 328
            .:::..:.:...::.:|:::..|
 Worm   323 IYIIVNLFIMIVAVGLTIVLAEI 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 61/258 (24%)
Neur_chan_memb 248..>359 CDD:280999 20/82 (24%)
Neur_chan_memb <683..760 CDD:280999
lgc-18NP_510029.3 LGIC_ECD_cation 75..257 CDD:349790 53/218 (24%)
LGIC_TM_cation 259..>341 CDD:349853 20/82 (24%)
TM1 helix 263..284 CDD:349853 7/20 (35%)
TM2 helix 292..313 CDD:349853 2/20 (10%)
TM3 helix 323..341 CDD:349853 1/17 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.