DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and lgc-21

DIOPT Version :10

Sequence 1:NP_525079.3 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_510341.2 Gene:lgc-21 / 181516 WormBaseID:WBGene00007903 Length:462 Species:Caenorhabditis elegans


Alignment Length:68 Identity:15/68 - (22%)
Similarity:29/68 - (42%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 IFIKLRKMKSQVRRK-------SGERTLVINSLVVSLLLTANYLYNYFYSMFKPLISQQSHELQS 251
            ||::|  ||::.||.       :..|:::...|.:.|.......:::.:.....|:...|.....
 Worm    79 IFLQL--MKNEGRRSLYLGLTPALTRSVLYGGLRLGLYEPTKVSFDWAFGSTNVLVKIASGAFAG 141

  Fly   252 AFS 254
            |||
 Worm   142 AFS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_525079.3 LGIC_ECD_nAChR_proto_alpha-like 25..243 CDD:349832 11/55 (20%)
Cys-loop 150..164 CDD:349832
LGIC_TM_nAChR 242..>331 CDD:349866 4/13 (31%)
TM1 helix 242..266 CDD:349866 4/13 (31%)
TM2 helix 274..295 CDD:349866
TM3 helix 306..328 CDD:349866
Neur_chan_memb <683..760 CDD:460753
lgc-21NP_510341.2 LGIC_ECD 113..290 CDD:475126 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.