DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and lgc-21

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_510341.2 Gene:lgc-21 / 181516 WormBaseID:WBGene00007903 Length:462 Species:Caenorhabditis elegans


Alignment Length:299 Identity:70/299 - (23%)
Similarity:117/299 - (39%) Gaps:53/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 WVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYN------NADGNFEVTLATKATLNYT 135
            ::|.||:|.:|.|....:...:::.....|||.|.:...|      |.|. ||:   .|......
 Worm   139 YLELSWHDDRLMWNQDTWKKNKLVVHSFHHIWVPLLGSQNPENHLKNGDA-FEI---RKVETTNQ 199

  Fly   136 GRVEWRPPAIYKSSC-EIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGTNVVEVGVDLS 199
            |.|..:.....::.| :.|.|.:|.|...|...|..      |.| |.:.:...:. :.:..|..
 Worm   200 GNVSAKVAFSLRTFCDDTDFENYPNDVYKCCFSFEP------QQD-REVIQFTSSG-LPIFTDPK 256

  Fly   200 EFYTSVEWDIL-EVPAVRNEKFYTCCDEP--YLDITFNITMRRKTLFYTVNLIIPCMGISFLTIL 261
            .| ....|.:. .||    |.|    |:|  ...:.|.:.::|......:.|.||.    |:|..
 Worm   257 NF-RDYGWGVSGTVP----ESF----DDPSEIAQLGFCLNLKR
AHSSLKIELAIPL----FITTA 308

  Fly   262 VFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLG---------KFVLFTMILDTF 317
            :|.||...|   |:.|.|.|.:.|..|....::..::.:.|.|.         :|:...::.:..
 Worm   309 LFLLPPLFG---SVKIQIYLKMFVMGLQFMTLLIFSTRIAPFLSSTASTPKPMRFLEIALVFNLI 370

  Fly   318 SICVTVLVLNIHFRSPQT-HTMAPWVR-TVFINQLPRFL 354
            ||..::::    |...|. .|:.||.| |.|.|.:..||
 Worm   371 SITTSIII----FCCMQVKRTLPPWGRVTQFANFINGFL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 39/173 (23%)
Neur_chan_memb 248..>359 CDD:280999 31/118 (26%)
Neur_chan_memb <683..760 CDD:280999
lgc-21NP_510341.2 LGIC_ECD 113..290 CDD:355788 38/171 (22%)
Cys-loop 214..229 CDD:349787 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.