DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and CHRNG

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_005190.4 Gene:CHRNG / 1146 HGNCID:1967 Length:517 Species:Homo sapiens


Alignment Length:376 Identity:142/376 - (37%)
Similarity:222/376 - (59%) Gaps:26/376 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MILVLSFISSSTANPDAKRLYDDLLSNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKNQIMTT 74
            ::|:|:....:......:||..||:.||:..:||....:|.:.|.:||.|:.||.:|.:.:.:||
Human    10 LLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT 74

  Fly    75 NLWVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNYTGRVE 139
            |:|:|..|.||:|:|:|::|.|:.:|.|||..:|||||||.||.||.|||.|.....::..|.:.
Human    75 NVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIY 139

  Fly   140 WRPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGTNVVEVGVDLSEFYTS 204
            |.||||::|:|.|.|.|||||.|.|.:.|.|.||...::||: :.:.:|..:..:.:|...|..:
Human   140 WLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQ-LSQEDGQTIEWIFIDPEAFTEN 203

  Fly   205 VEWDILEVPAVRNEKFYTCCDEPYLD------------ITFNITMRRKTLFYTVNLIIPCMGISF 257
            .||.|...||           :..||            :.|.:.::||.|||.:|:|.||:.||.
Human   204 GEWAIQHRPA-----------KMLLDPAAPAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISS 257

  Fly   258 LTILVFYLPSDS-GEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICV 321
            :.||:.:||:.: |:|.:::|::||:.|||..|:|:.:|.||..|||:.|::.|.:::....:..
Human   258 VAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQAVPLISKYLTFLLVVTILIVVN 322

  Fly   322 TVLVLNIHFRSPQTHTMAPWVRTVFINQLPRFLVMR-RPLYPISEMIKSSR 371
            .|:|||:..|||.||:||..||.||:..||:.|.|. |||.|.:.....||
Human   323 AVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 83/226 (37%)
Neur_chan_memb 248..>359 CDD:280999 46/112 (41%)
Neur_chan_memb <683..760 CDD:280999
CHRNGNP_005190.4 LGIC_ECD_nAChR_G 49..241 CDD:349830 75/203 (37%)
Neur_chan_memb 248..492 CDD:397193 52/126 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.