DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and chrng

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001241879.1 Gene:chrng / 100536659 ZFINID:ZDB-GENE-030131-3805 Length:540 Species:Danio rerio


Alignment Length:354 Identity:146/354 - (41%)
Similarity:215/354 - (60%) Gaps:13/354 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILVLSFISSSTANPDAKRLYDDLLSNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKNQIMTTN 75
            ||:..| |.:..|.:.. |:.||:..|||.:|||.:..|.:.|:||:.|:.||.:|.|.:.:||.
Zfish    14 ILLFRF-SGALCNLEGS-LHRDLMVGYNKNIRPVESHEDIIDVKIKMTLTNLISLNEKEETLTTC 76

  Fly    76 LWVEQSWYDYKLKWEPKE----YGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNYTG 136
            :|:|..|.||:|:|..:.    |..:..:.:||..||.|||.|.||.||.|||.|.....::..|
Zfish    77 VWIEMQWRDYRLRWANRTGFEVYENITRMRLPSKTIWLPDIGLENNVDGRFEVALYANTLIDPDG 141

  Fly   137 RVEWRPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGTNVVEVGVDLSEF 201
            .|.|.|||||:|||.|.|.|||||.|.|.|.|.|.||:..::.|...||.|.| :..:.:|...|
Zfish   142 SVYWLPPAIYRSSCAIKVNYFPFDWQNCSMVFRSQTYNSNEITLMLSDEDNVT-MEWIEIDPEAF 205

  Fly   202 YTSVEWDILEVPA--VRNEKFYTCCDE-PYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVF 263
            ..:.||.|...||  |.|:::..  || .:.:|.|.:.::||.|||.:|:|:||:..|.|.:||:
Zfish   206 TENGEWMIKHRPAKKVINKRYRP--DELEHQEIIFFLIIQRKPLFYVINIIVPCVLFSSLGLLVY 268

  Fly   264 YLPSDS-GEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVLVLN 327
            :||:.: |:|.:::|.|||..|||..|:|:.:|.||..|||:||:::|.|.:.|.::...|:|||
Zfish   269 FLPAKAGGQKCTMTICILLGQTVFLFLIAKKVPETSQAVPLIGKYLMFVMSVTTITVMNCVVVLN 333

  Fly   328 IHFRSPQTHTMAPWVRTVFINQLPRFLVM 356
            :..|:|.||.|:..:|.|.:|.|||.|.|
Zfish   334 VSLRTPNTHPMSNTIRKVLLNILPRVLRM 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 88/221 (40%)
Neur_chan_memb 248..>359 CDD:280999 48/110 (44%)
Neur_chan_memb <683..760 CDD:280999
chrngNP_001241879.1 LIC 21..511 CDD:273305 142/346 (41%)
Neur_chan_LBD 27..246 CDD:280998 88/222 (40%)
Neur_chan_memb 253..509 CDD:280999 48/110 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.