DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha3 and chrne

DIOPT Version :9

Sequence 1:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster
Sequence 2:XP_002941867.4 Gene:chrne / 100497712 XenbaseID:XB-GENE-979686 Length:505 Species:Xenopus tropicalis


Alignment Length:386 Identity:154/386 - (39%)
Similarity:238/386 - (61%) Gaps:9/386 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLSFISSSTAN-PDAKRLYDDLLSNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKNQIMTTNL 76
            :|..:.:|.|| .:..||...|.:||:...||...:.|.:.|.:||.|:.|||:|.|.:.:|||:
 Frog    10 LLILLHNSLANESEESRLIKYLFTNYDSKARPSKGIDDVVPVSLKLTLTNLIDLNEKEETLTTNV 74

  Fly    77 WVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNYTGRVEWR 141
            ||:.:|.|.:|.|...||||:.::.||.|.:|.|:|||.||.||||||.......::.||.:.|.
 Frog    75 WVQIAWQDDRLTWNETEYGGMPLVQVPHDMMWLPEIVLENNIDGNFEVAYYANVLVHSTGYIYWL 139

  Fly   142 PPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHI-DELNGTNVVEVGVDLSEFYTSV 205
            ||||::|:|.|::.|||||.|.|.:.|.|.||....:||..: |:..|....:|.:|...|..:.
 Frog   140 PPAIFRSTCSIEITYFPFDWQNCSLVFRSKTYSANDIDLHLVADDETGLPFDQVDIDREAFTENG 204

  Fly   206 EWDILEVPA--VRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYLPSD 268
            ||.|:..||  :.|.| |:..|..|.:|.|.:.::||.|||.:|:|:||:.||.|.:||::||:.
 Frog   205 EWAIMHRPARKIVNPK-YSKEDLRYQEIVFILIIQRKPLFYIINIIVPCVLISSLVVLVYFLPAK 268

  Fly   269 S-GEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVLVLNIHFRS 332
            : |:|.::|||:||:.|||..|:|::||.|||.|||:||:::|.|.:.|..:...|:|||:..||
 Frog   269 AGGQKCTVSISVLLAQTVFLFLIAQMIPETSLSVPLIGKYLMFVMFVSTLIVLSCVIVLNVSLRS 333

  Fly   333 PQTHTMAPWVRTVFINQLPRFLVMRRPLYPISEMIKSSRRLMVRTCNGLELRDQIPPLPPP 393
            |.|||::..|:.:.:..||:|:.:|  :.|..|..::.|... |:..|:.|:.:...|..|
 Frog   334 PSTHTLSSKVKHMLLEVLPQFIHLR--VEPCDEGEETPRERR-RSSLGIMLKAEEYVLKKP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 87/217 (40%)
Neur_chan_memb 248..>359 CDD:280999 50/111 (45%)
Neur_chan_memb <683..760 CDD:280999
chrneXP_002941867.4 LGIC_ECD_nAChR_G 47..241 CDD:349830 80/194 (41%)
Neur_chan_memb 248..491 CDD:397193 58/147 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.