DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15343 and Pnpo

DIOPT Version :9

Sequence 1:NP_572469.1 Gene:CG15343 / 31765 FlyBaseID:FBgn0030029 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_072123.1 Gene:Pnpo / 64533 RGDID:621456 Length:261 Species:Rattus norvegicus


Alignment Length:197 Identity:44/197 - (22%)
Similarity:84/197 - (42%) Gaps:31/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPVEFFKEILQEAAKGHPDGFIQEMNLATVDEEFGVLNRTVLYRGLTQDNCVFYITHRYVRNFKN 78
            ||::.|....:||.:....|....|.|||...:.....|.:|.:|..:|...|: |:...|..|.
  Rat    57 DPMKQFASWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFF-TNYESRKGKE 120

  Fly    79 LQANPKACITFYMPDVKDKAGNQNAW-----QVRLIGATAVELDQSEMDALWAKENLAAQI---- 134
            |.:||.|.:.||             |     |||:.|... :|.:.|.:..:.....::||    
  Rat   121 LDSNPFASLVFY-------------WEPLNRQVRVEGPVK-KLPEKEAENYFHSRPKSSQIGAVV 171

  Fly   135 --RGHICPCGEPINYDDLKAKHDQFLLDHRGKSIERPASYTAWKFQPQRWDFLKVGLDQIADRVQ 197
              :..:.|     :.:.|:.|:::....:|.:.:.:|..:..:...||..:|.:...:::.||:.
  Rat   172 SRQSSVIP-----DREYLRKKNEELGQLYREQEVPKPEYWGGYILYPQVMEFWQGQTNRLHDRIV 231

  Fly   198 YR 199
            :|
  Rat   232 FR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15343NP_572469.1 pdxH 14..207 CDD:273138 44/197 (22%)
Pyridox_oxidase 34..120 CDD:279568 24/90 (27%)
PnpoNP_072123.1 Pyridoxal 5'-phosphate binding. /evidence=ECO:0000250|UniProtKB:P0AFI7 42..45
pdxH 57..261 CDD:273138 44/197 (22%)
Pyridoxal 5'-phosphate binding. /evidence=ECO:0000250|UniProtKB:P0AFI7 225..227 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.