DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15343 and PNPO

DIOPT Version :9

Sequence 1:NP_572469.1 Gene:CG15343 / 31765 FlyBaseID:FBgn0030029 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_060599.1 Gene:PNPO / 55163 HGNCID:30260 Length:261 Species:Homo sapiens


Alignment Length:197 Identity:45/197 - (22%)
Similarity:85/197 - (43%) Gaps:31/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPVEFFKEILQEAAKGHPDGFIQEMNLATVDEEFGVLNRTVLYRGLTQDNCVFYITHRYVRNFKN 78
            |||:.|....:||.:....|....|.|||...:.....|.:|.:|..:|...|: |:...|..|.
Human    57 DPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFF-TNFESRKGKE 120

  Fly    79 LQANPKACITFYMPDVKDKAGNQNAW-----QVRLIGATAVELDQSEMDALWAKENLAAQI---- 134
            |.:||.|.:.||             |     |||:.|... :|.:.|.:..:.....::||    
Human   121 LDSNPFASLVFY-------------WEPLNRQVRVEGPVK-KLPEEEAECYFHSRPKSSQIGAVV 171

  Fly   135 --RGHICPCGEPINYDDLKAKHDQFLLDHRGKSIERPASYTAWKFQPQRWDFLKVGLDQIADRVQ 197
              :..:.|     :.:.|:.|:::....::.:.:.:|.|:..:...||..:|.:...:::.||:.
Human   172 SHQSSVIP-----DREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIV 231

  Fly   198 YR 199
            :|
Human   232 FR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15343NP_572469.1 pdxH 14..207 CDD:273138 45/197 (23%)
Pyridox_oxidase 34..120 CDD:279568 24/90 (27%)
PNPONP_060599.1 Pyridoxal 5'-phosphate binding. /evidence=ECO:0000250|UniProtKB:P0AFI7 42..45
pdxH 57..261 CDD:273138 45/197 (23%)
Pyridoxal 5'-phosphate binding. /evidence=ECO:0000250|UniProtKB:P0AFI7 225..227 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.