Sequence 1: | NP_572469.1 | Gene: | CG15343 / 31765 | FlyBaseID: | FBgn0030029 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060599.1 | Gene: | PNPO / 55163 | HGNCID: | 30260 | Length: | 261 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 85/197 - (43%) | Gaps: | 31/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 DPVEFFKEILQEAAKGHPDGFIQEMNLATVDEEFGVLNRTVLYRGLTQDNCVFYITHRYVRNFKN 78
Fly 79 LQANPKACITFYMPDVKDKAGNQNAW-----QVRLIGATAVELDQSEMDALWAKENLAAQI---- 134
Fly 135 --RGHICPCGEPINYDDLKAKHDQFLLDHRGKSIERPASYTAWKFQPQRWDFLKVGLDQIADRVQ 197
Fly 198 YR 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15343 | NP_572469.1 | pdxH | 14..207 | CDD:273138 | 45/197 (23%) |
Pyridox_oxidase | 34..120 | CDD:279568 | 24/90 (27%) | ||
PNPO | NP_060599.1 | Pyridoxal 5'-phosphate binding. /evidence=ECO:0000250|UniProtKB:P0AFI7 | 42..45 | ||
pdxH | 57..261 | CDD:273138 | 45/197 (23%) | ||
Pyridoxal 5'-phosphate binding. /evidence=ECO:0000250|UniProtKB:P0AFI7 | 225..227 | 0/1 (0%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1337072at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10851 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |