DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15343 and pnpo

DIOPT Version :9

Sequence 1:NP_572469.1 Gene:CG15343 / 31765 FlyBaseID:FBgn0030029 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001243107.1 Gene:pnpo / 402868 ZFINID:ZDB-GENE-060602-2 Length:277 Species:Danio rerio


Alignment Length:225 Identity:51/225 - (22%)
Similarity:89/225 - (39%) Gaps:60/225 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPVEFFKEILQEAAKGHPDGFIQEMNLATVDEEFGVLNRTVLYRGLTQDNCVFYITHRYVRNFKN 78
            ||::.|.....:|.|....|....|.|||..::.....|.||.:|.:::...|:..:. .|....
Zfish    74 DPIKQFGSWFDQATKCPEVGEANAMCLATATKDGHPSARMVLLKGYSEEGFCFFSNYE-SRKGSE 137

  Fly    79 LQANPKACITFYMPDVKDKAGNQNAW-----QVRLIGATAVEL--------------DQSEMDAL 124
            |::||.||:.||             |     |:|:.|  .||.              ..|::.|:
Zfish   138 LESNPHACLVFY-------------WEPLNRQIRIEG--TVERIPYEKSREYFHSRPKSSQIGAV 187

  Fly   125 WAKENLAAQIRGHICPCGEPINYDDLKAK-HDQF------LLDHRGKSIERPASYTAWKFQPQRW 182
            .::::.....|.::         .|..|: .::|      :.|:.|..|.:|:....|:.|..|.
Zfish   188 VSRQSTVIPSRQYL---------RDKNAELEEKFKDTDVPMPDYWGGYIVKPSLIEFWQGQTNRL 243

  Fly   183 D----FL--KVGLDQIADRVQYRLQKDGKW 206
            .    ||  |.|..::.| :|:  |.:|.|
Zfish   244 HDRIVFLRPKGGETELGD-MQH--QAEGGW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15343NP_572469.1 pdxH 14..207 CDD:273138 51/225 (23%)
Pyridox_oxidase 34..120 CDD:279568 23/104 (22%)
pnpoNP_001243107.1 pdxH 74..277 CDD:273138 51/225 (23%)
Pyridox_oxidase 94..167 CDD:279568 23/88 (26%)
PNPOx_C 223..277 CDD:287549 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.