DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15343 and SPAC1093.02

DIOPT Version :9

Sequence 1:NP_572469.1 Gene:CG15343 / 31765 FlyBaseID:FBgn0030029 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_594650.1 Gene:SPAC1093.02 / 2542998 PomBaseID:SPAC1093.02 Length:231 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:41/202 - (20%)
Similarity:82/202 - (40%) Gaps:14/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSLAKIEDFPSDPVEFFKEILQEAAKGHPDGFIQEMNLATVDEEFG-VLNRTVLYRGLTQDNCVF 66
            |||.:......||:..|.:..|||.........:...|:|.....| |.:|.||.:.|.....:.
pombe    24 SSLHRDALMGKDPLVLFNQWFQEATDDEGIKSPESTTLSTARLPSGRVSSRLVLLKELDHRGFII 88

  Fly    67 YITHRYVRNFKNLQANPKACITFYMPDVKDKAGNQNAWQVRLIGATAVELDQSEMDALWAKENLA 131
            :......:..|:|::||.|.::|:...::.        |||:.|... .|.:.|.:..:......
pombe    89 FTNLGTSKKAKDLKSNPYASLSFWWEPLQR--------QVRVEGIIE-RLSREETEEYFKTRPRN 144

  Fly   132 AQIRGHICPCGEPI-NYDDLKAKHDQF---LLDHRGKSIERPASYTAWKFQPQRWDFLKVGLDQI 192
            ::|.....|..|.| :.::|:.:.:::   ..:.....:..|..:...:..|...:|.:.|..::
pombe   145 SRIGAWASPQSEVIADREELEKRVEEYKKKFGEDESVPVPVPDFWGGIRIVPLEIEFWQGGKYRL 209

  Fly   193 ADRVQYR 199
            .||..:|
pombe   210 HDRFSFR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15343NP_572469.1 pdxH 14..207 CDD:273138 38/191 (20%)
Pyridox_oxidase 34..120 CDD:279568 19/86 (22%)
SPAC1093.02NP_594650.1 PdxH 13..231 CDD:223337 41/202 (20%)
Pyridox_oxidase 51..133 CDD:279568 19/90 (21%)
PNPOx_C 189..231 CDD:287549 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.