DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15343 and pnpo

DIOPT Version :9

Sequence 1:NP_572469.1 Gene:CG15343 / 31765 FlyBaseID:FBgn0030029 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001120016.1 Gene:pnpo / 100144978 XenbaseID:XB-GENE-955839 Length:228 Species:Xenopus tropicalis


Alignment Length:215 Identity:47/215 - (21%)
Similarity:88/215 - (40%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPV----EFFKEILQEAAKGHPDGFIQEMNLATVDEEFGVLNRTVLYRGLTQDNCVFYITHRYVR 74
            ||:    .:|:|:.|..|...|:.    |.|||...:.....|.||.:|...|...|| |:|..|
 Frog    26 DPIIQFNAWFQEVTQCPAIEEPNA----MCLATATRDGRPSARMVLLKGFGPDGFRFY-TNRESR 85

  Fly    75 NFKNLQANPKACITFYMPDVKDKAGNQNAW-----QVRLIGATAVELDQSEMDALWAKENLAAQI 134
            ....|:.||.|.:.||             |     |||:.|:.. .|.:.|.:..:.....::||
 Frog    86 KGLELETNPVASLLFY-------------WEPFNRQVRIEGSIE-RLSEEESEKYFHSRPKSSQI 136

  Fly   135 RGHICPCGEPI-NYDDLKAKHDQFLLDHRGKSIERPASYTAWKFQPQRWDFLKVGLDQIADRVQY 198
            ...:....:.| :.:.|:.|:.:...:::.:.:.:|..:..:...|...:|.:...:::.||:.:
 Frog   137 GAAVSKQSQVIPDREYLRQKNAELEAEYKDREVPKPPEWGGYVVHPTVIEFWQGQTNRLHDRIVF 201

  Fly   199 RLQK------------DGKW 206
            ..|:            :|.|
 Frog   202 HKQEKDEELALWTHRGEGGW 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15343NP_572469.1 pdxH 14..207 CDD:273138 47/215 (22%)
Pyridox_oxidase 34..120 CDD:279568 26/90 (29%)
pnpoNP_001120016.1 pdxH 26..228 CDD:273138 47/215 (22%)
Pyridox_oxidase 44..122 CDD:279568 27/96 (28%)
PNPOx_C 175..228 CDD:287549 7/47 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10851
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.