DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Fzd10

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_780493.1 Gene:Fzd10 / 93897 MGIID:2136761 Length:582 Species:Mus musculus


Alignment Length:193 Identity:55/193 - (28%)
Similarity:78/193 - (40%) Gaps:35/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 RCSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDT 448
            :|.|:|:..|:.:|||.|..|||:||.:..:.|..:..|..||:..||.....|:|.|..|.|..
Mouse    34 KCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTE 98

  Fly   449 HGSDLQPTPGQICREYCESFMAGCGGRLPQ---RFRQFFDCERFP-ESTGTQSCHQKPHCVSDMQ 509
            ..|    ||...||..||.....|...:.|   |:....||.:.| ::.....|.:.|:..||..
Mouse    99 QVS----TPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEP 159

  Fly   510 S----------------NVQSPRLCD---GYADCPD------LSDERSCA-FCSPNA-LYCGR 545
            |                :.|...|.|   |.|.|.:      :....||| .|:|.. :|..|
Mouse   160 SRGSGMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 38/121 (31%)
PRKCSH-like <503..>582 CDD:193472 16/70 (23%)
LDLa 536..571 CDD:238060 4/11 (36%)
Tryp_SPc 708..>809 CDD:304450
Fzd10NP_780493.1 CRD_FZ 31..157 CDD:295308 39/126 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..189 6/35 (17%)
Frizzled 219..536 CDD:279827 2/4 (50%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 527..532
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 561..582
PDZ-binding 580..582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.