DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1632 and MFRP

DIOPT Version :9

Sequence 1:	NP_001245577.1	Gene:	CG1632 / 31763	FlyBaseID:	FBgn0030027	Length:	1056	Species:	Drosophila melanogaster
Sequence 2:	NP_113621.1	Gene:	MFRP / 83552	HGNCID:	18121	Length:	579	Species:	Homo sapiens

Alignment Length:	140	Identity:	41/140 - (29%)
Similarity:	67/140 - (47%)	Gaps:	14/140 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   365 GGHDETTEPVVTTTPAPPRRCSPLELSYCRQVGYNITTYPNL-LGHASYEQLAEDVIVFRELVDG 428
            |..|..:.|:.   |.|...|.|:::..|..:.||.|.:||: :|..:.|::.|.:..::.|...
Human   449 GSDDNCSGPLF---PPPELACEPVQVEMCLGLSYNTTAFPNIWVGMITQEEVVEVLSGYKSLTSL 510

  Fly   429 ECHREAYDFVCRLLQPPCDTHGSDLQPTPGQICRE---YCESFMAGCGGRLPQRFRQFFDCERFP 490
            .|::.....:|.||.|.|...||.|.|. ..:|:|   .|:|.:|..|...|      |:|.|.|
Human   511 PCYQHFRRLLCGLLVPRCTPLGSVLPPC-RSVCQEAEHQCQSGLALLGTPWP------FNCNRLP 568

  Fly   491 ESTGTQSCHQ 500
            |:...::|.|
Human   569 EAADLEACAQ 578

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1632	NP_001245577.1	SEA	232..327	CDD:279699
		CRD_FZ	384..502	CDD:143549	36/121 (30%)
		PRKCSH-like	<503..>582	CDD:193472
		LDLa	536..571	CDD:238060
		Tryp_SPc	708..>809	CDD:304450
MFRP	NP_113621.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	100..143
		CUB	144..252	CDD:238001
		LDLa	260..294	CDD:238060
		CUB	301..411	CDD:238001
		LDLa	421..454	CDD:238060	2/4 (50%)
		Fz	466..569	CDD:279700	32/109 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3577
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900