| Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_003498.1 | Gene: | FZD7 / 8324 | HGNCID: | 4045 | Length: | 574 | Species: | Homo sapiens |
| Alignment Length: | 322 | Identity: | 79/322 - (24%) |
|---|---|---|---|
| Similarity: | 109/322 - (33%) | Gaps: | 101/322 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
Fly 450 GSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVSD 507
Fly 508 MQSNVQSPRLCDG----------YADCPDLSDERSCAFCSPNALYCGRGR-----ACVPRKARCD 557
Fly 558 --------GKADC-----PDGAD------EKD---------------CLS----IAPLAADLLQ- 583
Fly 584 --PEPLVPYLSR-------FHSAGYAVFSEKGVVGKLCAEGLEGDAKLVVRQTVSESLCKSL 636 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
| CRD_FZ | 384..502 | CDD:143549 | 39/123 (32%) | ||
| PRKCSH-like | <503..>582 | CDD:193472 | 25/131 (19%) | ||
| LDLa | 536..571 | CDD:238060 | 14/73 (19%) | ||
| Tryp_SPc | 708..>809 | CDD:304450 | |||
| FZD7 | NP_003498.1 | CRD_FZ7 | 45..169 | CDD:143575 | 41/142 (29%) |
| 7tmF_FZD7 | 243..573 | CDD:320374 | 19/102 (19%) | ||
| TM helix 1 | 253..277 | CDD:320374 | 2/23 (9%) | ||
| TM helix 2 | 286..307 | CDD:320374 | 5/20 (25%) | ||
| TM helix 3 | 337..359 | CDD:320374 | 1/3 (33%) | ||
| TM helix 4 | 380..396 | CDD:320374 | |||
| TM helix 5 | 418..441 | CDD:320374 | |||
| TM helix 6 | 472..494 | CDD:320374 | |||
| TM helix 7 | 523..548 | CDD:320374 | |||
| Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 552..557 | ||||
| PDZ-binding | 572..574 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||