DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and FZD6

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001158087.1 Gene:FZD6 / 8323 HGNCID:4044 Length:706 Species:Homo sapiens


Alignment Length:286 Identity:64/286 - (22%)
Similarity:101/286 - (35%) Gaps:78/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
            |.|:.:..|.::.||:|.:|||:||......|.::..|..|.:.||......|:|:...|.|...
Human    24 CEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQ 88

  Fly   450 GSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVSD 507
            ...:.|     ||:.||...:.|       |.|.|:.    .:|:|.      |.|.:......|
Human    89 IHVVPP-----CRKLCEKVYSDCKKLIDTFGIRWPEE----LECDRL------QYCDETVPVTFD 138

  Fly   508 MQSNVQSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRA--------CVPRKARCDGKADCPD 564
            ..:....|:......       :|...|..|..|....|:.        |.|         .||:
Human   139 PHTEFLGPQKKTEQV-------QRDIGFWCPRHLKTSGGQGYKFLGIDQCAP---------PCPN 187

  Fly   565 ---GADEKD-------CLSIAPLAADLL-------------QPE-PLVPYLSRFHSAGYAVFSEK 605
               .:||.:       .:||..|.|.|.             .|| |::     ::|..|::.|..
Human   188 MYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPII-----YYSVCYSIVSLM 247

  Fly   606 GVVGKLCAEGL---EGDAKLVVRQTV 628
            ..:|.|..:..   :.|.||.:..||
Human   248 YFIGFLLGDSTACNKADEKLELGDTV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 33/123 (27%)
PRKCSH-like <503..>582 CDD:193472 17/96 (18%)
LDLa 536..571 CDD:238060 9/52 (17%)
Tryp_SPc 708..>809 CDD:304450
FZD6NP_001158087.1 CRD_FZ6 20..146 CDD:143559 34/136 (25%)
Frizzled 189..507 CDD:279827 20/90 (22%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 498..503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 588..706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.