DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and FZD3

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_059108.1 Gene:FZD3 / 7976 HGNCID:4041 Length:666 Species:Homo sapiens


Alignment Length:228 Identity:57/228 - (25%)
Similarity:89/228 - (39%) Gaps:61/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 LGGHDETTEPVVTTTPAPPRRCSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDG 428
            :|||...:             |.|:.|..|:.:.||.|..||||.|...:..|..:..|..:|:.
Human    20 IGGHSLFS-------------CEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNL 71

  Fly   429 ECHREAYDFVCRLLQPPCDTHGSDLQPTPGQICREYCESFMAGCGGRLPQRF----RQFFDCERF 489
            :|.|:...|:|.|..|.|..:|....|     ||..|:...:.| .:|.:.|    .:..:|.||
Human    72 DCSRDFRPFLCALYAPICMEYGRVTLP-----CRRLCQRAYSEC-SKLMEMFGVPWPEDMECSRF 130

  Fly   490 PESTGTQSCHQKPHCVSDMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRACVPRKA 554
            |:      | .:|:           |||.|     .:|:.|.:..  :|.|:....|..| ||:.
Human   131 PD------C-DEPY-----------PRLVD-----LNLAGEPTEG--APVAVQRDYGFWC-PREL 169

  Fly   555 RCDG------------KADCPDGADEKDCLSIA 575
            :.|.            ...||:....::.||.|
Human   170 KIDPDLGYSFLHVRDCSPPCPNMYFRREELSFA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 35/121 (29%)
PRKCSH-like <503..>582 CDD:193472 18/85 (21%)
LDLa 536..571 CDD:238060 9/46 (20%)
Tryp_SPc 708..>809 CDD:304450
FZD3NP_059108.1 CRD_FZ3 24..150 CDD:143558 42/167 (25%)
7tmF_FZD3 192..512 CDD:320161 3/11 (27%)
TM helix 1 201..226 CDD:320161 1/2 (50%)
TM helix 2 235..256 CDD:320161
TM helix 3 287..313 CDD:320161
TM helix 4 330..352 CDD:320161
TM helix 5 366..391 CDD:320161
TM helix 6 419..444 CDD:320161
TM helix 7 473..498 CDD:320161
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 502..507
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 538..666
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.