Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_059108.1 | Gene: | FZD3 / 7976 | HGNCID: | 4041 | Length: | 666 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 57/228 - (25%) |
---|---|---|---|
Similarity: | 89/228 - (39%) | Gaps: | 61/228 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 364 LGGHDETTEPVVTTTPAPPRRCSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDG 428
Fly 429 ECHREAYDFVCRLLQPPCDTHGSDLQPTPGQICREYCESFMAGCGGRLPQRF----RQFFDCERF 489
Fly 490 PESTGTQSCHQKPHCVSDMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRACVPRKA 554
Fly 555 RCDG------------KADCPDGADEKDCLSIA 575 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
CRD_FZ | 384..502 | CDD:143549 | 35/121 (29%) | ||
PRKCSH-like | <503..>582 | CDD:193472 | 18/85 (21%) | ||
LDLa | 536..571 | CDD:238060 | 9/46 (20%) | ||
Tryp_SPc | 708..>809 | CDD:304450 | |||
FZD3 | NP_059108.1 | CRD_FZ3 | 24..150 | CDD:143558 | 42/167 (25%) |
7tmF_FZD3 | 192..512 | CDD:320161 | 3/11 (27%) | ||
TM helix 1 | 201..226 | CDD:320161 | 1/2 (50%) | ||
TM helix 2 | 235..256 | CDD:320161 | |||
TM helix 3 | 287..313 | CDD:320161 | |||
TM helix 4 | 330..352 | CDD:320161 | |||
TM helix 5 | 366..391 | CDD:320161 | |||
TM helix 6 | 419..444 | CDD:320161 | |||
TM helix 7 | 473..498 | CDD:320161 | |||
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 502..507 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 538..666 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |