DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and szl

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001037971.1 Gene:szl / 733750 XenbaseID:XB-GENE-482077 Length:281 Species:Xenopus tropicalis


Alignment Length:364 Identity:71/364 - (19%)
Similarity:115/364 - (31%) Gaps:132/364 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 PLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPC-DTHG 450
            |.|::.|..:||:....|||:||.|..::......::.|:...||..|..|:|.|..|.| ||. 
 Frog    31 PKEMAMCNDIGYSEMRLPNLMGHTSMAEVVPKSAEWQNLLQTGCHPYARMFLCSLFAPVCLDTF- 94

  Fly   451 SDLQPTPGQICREYCESFMAGCGGRLP---QRFRQFFDCERFPESTGTQSCHQKPHCVSDMQSNV 512
              :||     ||..|.:....|...|.   ..:.:..||:|||..        :..|:..:....
 Frog    95 --IQP-----CRSMCVAVRDSCAPVLACHGHAWPESLDCDRFPAG--------EDMCLDTLSKEY 144

  Fly   513 QSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRACVPRKARCDGKADCPDGADEKDCLSIAPL 577
            |.     .|.:.|                           |..|.|                .||
 Frog   145 QY-----SYKELP---------------------------KPSCQG----------------CPL 161

  Fly   578 AADLLQPEPLVPYLSRFHSAGYAVFSEKGVVGKLCAEGLEGDAKLVVRQTVSESLCKSLGYESVE 642
            ..|.                    ||.|.|:...|........||..::|.|          .:.
 Frog   162 IEDF--------------------FSHKTVLEAFCDNNFAVKVKLAKKKTTS----------GIY 196

  Fly   643 IFDVQNDTERLNDYVRVLDPH-----APEISFIRTHCPRRQV-----LYVGCGELRCGVQSALFN 697
            :::.:...|.:..  .:|.|:     ..:...|..:|.:|.:     :||..|::..|       
 Frog   197 VYETEGPVEFIKQ--GLLLPYDTRTMIEQWLLINENCAQRLIRNRPTVYVIAGDIHHG------- 252

  Fly   698 AKQHLSLPKMSAPGDWPWLVALFREDIHVCDGTLITQDW 736
                    |:|....:.|.    ::|..:   ||.|:.|
 Frog   253 --------KVSVNRVFHWQ----KKDSQL---TLATRRW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 34/118 (29%)
PRKCSH-like <503..>582 CDD:193472 10/78 (13%)
LDLa 536..571 CDD:238060 3/34 (9%)
Tryp_SPc 708..>809 CDD:304450 7/29 (24%)
szlNP_001037971.1 CRD_sizzled 19..159 CDD:143561 41/191 (21%)
NTR_Sfrp1_like 153..281 CDD:239635 33/194 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.