DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1632 and vldlr

DIOPT Version :9

Sequence 1:	NP_001245577.1	Gene:	CG1632 / 31763	FlyBaseID:	FBgn0030027	Length:	1056	Species:	Drosophila melanogaster
Sequence 2:	XP_002934223.1	Gene:	vldlr / 733485	XenbaseID:	XB-GENE-971958	Length:	868	Species:	Xenopus tropicalis

Alignment Length:	142	Identity:	43/142 - (30%)
Similarity:	67/142 - (47%)	Gaps:	19/142 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   446 CD-----THGSDLQPTPGQICREYCESFMAGCGGRLPQRFR--QFFDCERFPESTGTQSCHQKPH 503
            ||     :.|||......:.|.|  ..|:...|..:|:|:.  ...|||...:.| .:.||.:..
Frog    50 CDGDEDCSDGSDESSCVKKTCAE--TDFVCNNGLCVPRRWECDGDPDCEDGSDET-AELCHMRTC 111

  Fly   504 CVSDMQSNVQSPRL------CDGYADCPDLSDERSCA--FCSPNALYCGRGRACVPRKARCDGKA 560
            ..:::....:|.:.      |||.:|||:..||.:|.  .|||....|..|| |:.....|:|:.
Frog   112 RATEISCGARSTQCIPLSWKCDGESDCPNAEDEENCGNITCSPAEFTCSSGR-CISSTFVCNGQN 175

  Fly   561 DCPDGADEKDCL 572
            ||.||:||::|:
Frog   176 DCSDGSDEENCV 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1632	NP_001245577.1	SEA	232..327	CDD:279699
		CRD_FZ	384..502	CDD:143549	17/62 (27%)
		PRKCSH-like	<503..>582	CDD:193472	26/78 (33%)
		LDLa	536..571	CDD:238060	15/34 (44%)
		Tryp_SPc	708..>809	CDD:304450
vldlr	XP_002934223.1	LDLa	31..65	CDD:238060	5/14 (36%)
		Ldl_recept_a	68..101	CDD:365841	9/34 (26%)
		Ldl_recept_a	109..147	CDD:365841	9/37 (24%)
		Ldl_recept_a	151..186	CDD:365841	15/35 (43%)
		LDLa	190..222	CDD:197566
		Ldl_recept_a	236..271	CDD:365841
		Ldl_recept_a	274..310	CDD:365841
		LDLa	316..348	CDD:197566
		FXa_inhibition	358..392	CDD:373209
		EGF_CA	394..424	CDD:214542
		LY	505..547	CDD:214531
		LY	548..591	CDD:214531
		LY	592..634	CDD:214531
		Ldl_recept_b	655..694	CDD:393440
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910