DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Prss22

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:361 Identity:79/361 - (21%)
Similarity:128/361 - (35%) Gaps:136/361 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 SAPGDWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQG---QPRATWMAIVGAVRLSAKAPWTQ 769
            |....|||:|::.:...|.|.|:|:|..||:|...||:.   :| :.:..::||.:|.:..|.:|
Mouse   114 SMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKP-SLFSVLLGAWKLGSPGPRSQ 177

  Fly   770 RRRIIGMIKSP----VEGSTA--ALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPV 828
            :..|..::..|    .||:.|  ||||||..:.:|:.:.||||||:..|    .||         
Mouse   178 KVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVR----LPP--------- 229

  Fly   829 AERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEA 893
                                          :.|......|...                      
Mouse   230 ------------------------------KTDCWIAGWGSIQ---------------------- 242

  Fly   894 LHQELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSRQR 958
                 ||.|||.  ||              |..::  |.||:.:         ..|.:|.|.   
Mouse   243 -----DGVPLPH--PQ--------------TLQKL--KVPIIDS---------ELCKSLYWR--- 272

  Fly   959 DHLQRVQLKMGDMAPCENVSIATVNSMCMEATY---QKYDCTQEEYSGAPVQCLIPGTNQWALIG 1020
                    ..|..|..|.:       :|  |.|   ::..|..:  ||.|:.|.:  .:.|.|.|
Mouse   273 --------GAGQEAITEGM-------LC--AGYLEGERDACLGD--SGGPLMCQV--DDHWLLTG 316

  Fly  1021 VSSWRIACGPTGVERPRMYDKIASNAAWIRETISAI 1056
            :.||...|...  .||.:|..:.::.:|::..:..:
Mouse   317 IISWGEGCAER--NRPGVYTSLLAHRSWVQRIVQGV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 38/109 (35%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 79/355 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.