DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Fzd4

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_072145.1 Gene:Fzd4 / 64558 RGDID:71017 Length:538 Species:Rattus norvegicus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:65/155 - (41%) Gaps:21/155 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LIEEPIMSSSPLGGHDETTEPVVTTTPAPPRRCSPLELSYCRQVGYNITTYPNLLGHASYEQLAE 417
            |::..::....||..||           ..|||.|:.::.|:.:|||:|..|||:||........
  Rat    25 LLQLLLLQRPALGFGDE-----------EERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAEL 78

  Fly   418 DVIVFRELVDGECHREAYDFVCRLLQPPCDTHGSDLQPTP-GQIC---REYCESFMAGCGGRLPQ 478
            .:..|..|:...|..:...|:|.:..|.| |...::...| |.:|   :..||..:...|...|.
  Rat    79 QLTTFTPLIQYGCSSQLQFFLCSVYVPMC-TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPD 142

  Fly   479 RFRQFFDCERF-PESTGTQSCHQKP 502
            .    .:|.:| |::.....|.:.|
  Rat   143 S----LNCSKFPPQNDHNHMCMEGP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 32/122 (26%)
PRKCSH-like <503..>582 CDD:193472 39/155 (25%)
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
Fzd4NP_072145.1 CRD_FZ4 43..168 CDD:143557 34/126 (27%)
Frizzled 211..510 CDD:279827
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 500..505
PDZ-binding 536..538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.