DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and SFRP5

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_003006.2 Gene:SFRP5 / 6425 HGNCID:10779 Length:317 Species:Homo sapiens


Alignment Length:124 Identity:35/124 - (28%)
Similarity:52/124 - (41%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 EPVVTTTPAPPRRC--SPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREA 434
            ||:...:.:.|.:|  .|.:|..|..|||.....||||.|.|..::.:....:..|:...||.:.
Human    40 EPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDT 104

  Fly   435 YDFVCRLLQPPCDTHGSDLQPTPGQICREYCESFMAGCGGRLPQ---RFRQFFDCERFP 490
            ..|:|.|..|.|       ...|...||..||:..|||...:..   .:.:...|.:||
Human   105 QVFLCSLFAPVC-------LDRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 32/112 (29%)
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
SFRP5NP_003006.2 CRD_SFRP5 47..173 CDD:143553 33/117 (28%)
NTR_Sfrp1_like 178..303 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5753
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.