DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and SFRP4

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_003005.2 Gene:SFRP4 / 6424 HGNCID:10778 Length:346 Species:Homo sapiens


Alignment Length:240 Identity:56/240 - (23%)
Similarity:89/240 - (37%) Gaps:56/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
            |..:.:..||.:.:|||..||.|.|::.|.....:..:.||||..|......|:|.:..|.|.. 
Human    24 CEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTL- 87

  Fly   450 GSDLQPTPGQICREYCESFMAGCGGRLPQRFRQFFDCE--------RFPESTGTQSCHQKP---- 502
              :....|.:.|:..|            ||.|.  |||        .:|||.   :|.:.|    
Human    88 --EFLHDPIKPCKSVC------------QRARD--DCEPLMKMYNHSWPESL---ACDELPVYDR 133

  Fly   503 -HCVS------DMQSNVQ----------SPRLCDGYADCPDLSDER-SCAFCSPN-ALYCGRGRA 548
             .|:|      |:..:|:          ..|..|  .||..||.:| .|....|. |.|..:..:
Human   134 GVCISPEAIVTDLPEDVKWIDITPDMMVQERPLD--VDCKRLSPDRCKCKKVKPTLATYLSKNYS 196

  Fly   549 -CVPRKARCDGKADCPDGADEKDCLSIAPLAADLLQPEPLVPYLS 592
             .:..|.:...::.|.:.....|...|...::.:  |...||.::
Human   197 YVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPI--PRTQVPLIT 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 33/124 (27%)
PRKCSH-like <503..>582 CDD:193472 19/97 (20%)
LDLa 536..571 CDD:238060 5/36 (14%)
Tryp_SPc 708..>809 CDD:304450
SFRP4NP_003005.2 CRD_FZ 20..146 CDD:321937 36/141 (26%)
NTR_like 188..296 CDD:321963 9/54 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.