DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG17242

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:357 Identity:57/357 - (15%)
Similarity:107/357 - (29%) Gaps:165/357 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   714 PWLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPRATWMAI-VGAVRLSAKAPWTQ----RRRI 773
            ||..::...|.|.|.|.:.::|.:||...|.: :.|..:::: ||:.:.:|.....:    |.::
  Fly    28 PWQASVQINDKHHCGGVIYSEDIILTIAECVR-KARLEFISVRVGSAQENAGGTVLKVEKMRLQV 91

  Fly   774 IGMIKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVS 838
            :|:..|.|     |:::|.:|:.....:|.|.|                 :.:|           
  Fly    92 LGLRPSDV-----AILQLRSPLYLDGGIRAIPL-----------------ATIP----------- 123

  Fly   839 QQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPL 903
                          |:|.                                               
  Fly   124 --------------LVPG----------------------------------------------- 127

  Fly   904 PDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSR------QRDHLQ 962
                                                       ||.:..||.:      ..:.|.
  Fly   128 -------------------------------------------TNASVSGWGQLSAMNPSSEVLL 149

  Fly   963 RVQLKMGDMAPC-ENVS----IATVNSMCMEATYQ-KYDCTQEEYSGAPVQCLIPGTNQWALIGV 1021
            ||.:|:.|...| .|::    :.:|..:|.....: .|.|  :.:.|.|    :...|:  |.|:
  Fly   150 RVDVKIQDQLMCATNLALKGRLMSVGEICAAPAGEIPYAC--QGFVGGP----LVANNR--LYGI 206

  Fly  1022 SSWRIACGPTGVERPRMYDKIASNAAWIRETI 1053
            .||:.||..  :.:..:|..||....||..|:
  Fly   207 LSWQSACDV--LNKSSVYANIAMFKVWIESTV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 24/99 (24%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 56/354 (16%)
Tryp_SPc 24..232 CDD:214473 54/351 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.