DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Fzd1

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_067089.2 Gene:Fzd1 / 58868 RGDID:61916 Length:642 Species:Rattus norvegicus


Alignment Length:266 Identity:67/266 - (25%)
Similarity:92/266 - (34%) Gaps:81/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LIEEPIM------SSSPLGGHDETTEPVVTTTPAPPRR------------------CSPLELSYC 393
            |:|.|::      ::..:.|..:...|     |..|::                  |.|:.:..|
  Rat    60 LLEAPLLLGVRAQAAGQVSGPGQQAPP-----PPQPQQGGQQYNGERGISIPDHGYCQPISIPLC 119

  Fly   394 RQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTHGSDLQPTPG 458
            ..:.||.|..||||||.:.|....:|..|..||..:|..|...|:|.:..|.|......|.|   
  Rat   120 TDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPP--- 181

  Fly   459 QICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVSDMQSNVQSPR 516
              ||..||....||       |.:.|...:    ||:||.....:.      ||....|:..:| 
  Rat   182 --CRSLCERARQGCEALMNKFGFQWPDTLK----CEKFPVHGAGEL------CVGQNTSDKGTP- 233

  Fly   517 LCDGYADCPDLSDERSCAFCSPNALYCGRG-RACVPRKA----RCDGKADCPDG----------- 565
                   .|.|..|    |.:.|..:.|.| |...|..|    |  ||..||..           
  Rat   234 -------TPSLLPE----FWTSNPQHGGGGYRGGYPGGAGPVER--GKFSCPRALRVPSYLNYHF 285

  Fly   566 ADEKDC 571
            ..||||
  Rat   286 LGEKDC 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 37/142 (26%)
PRKCSH-like <503..>582 CDD:193472 23/85 (27%)
LDLa 536..571 CDD:238060 13/50 (26%)
Tryp_SPc 708..>809 CDD:304450
Fzd1NP_067089.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..99 4/29 (14%)
CRD_FZ1 107..233 CDD:143574 40/140 (29%)
Frizzled 305..629 CDD:279827
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 620..625
PDZ-binding 640..642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.